Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized)
to candidate WP_022671297.1 G415_RS0108675 ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_16275 (244 letters) >NCBI__GCF_000420385.1:WP_022671297.1 Length = 248 Score = 130 bits (328), Expect = 2e-35 Identities = 80/246 (32%), Positives = 138/246 (56%), Gaps = 14/246 (5%) Query: 1 MISIKNVNKWYGDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDVVV 60 MI +K+++ + + +VL + + ++KG++ V+ G SG+GKS L+K + L KG ++V Sbjct: 1 MIEVKDLSVNFYNQKVLDELNLNIEKGKITVIIGKSGAGKSVLLKNIIGLLKPNKGSIIV 60 Query: 61 DGTSIADPKTD-LPKLRSRVGMVFQHFELFPHLTITENLTIAQI-KVLGRSKEEATKKGL 118 +G I + D L ++R G++FQ LF LT+ EN+ I + L ++K+E K Sbjct: 61 EGKDITKIRYDELKRIRLNFGVLFQEAALFDSLTVFENIAFPLIERKLIKNKKELKDKVK 120 Query: 119 QLLERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEVLDV 178 + L V L +K P +LSGG ++RV +ARA+ +P ++ FDEPT+ LDP + + Sbjct: 121 EALSLVELHDIENKLPSELSGGMKKRVGLARAIITNPKIIFFDEPTTGLDPITAMSIAKL 180 Query: 179 MVQLANE-GMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEEFFGDI----NARSDR 233 + + T ++H++ K+ADR+ F+ +GKIIE FGD N+ + Sbjct: 181 IKNMQQTLNTTCFIISHDLALTFKIADRIGFLHEGKIIE-------FGDAEQIKNSNNPI 233 Query: 234 AQHFLD 239 + FL+ Sbjct: 234 VKEFLE 239 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 248 Length adjustment: 24 Effective length of query: 220 Effective length of database: 224 Effective search space: 49280 Effective search space used: 49280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory