Align PEP1B, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_022669622.1 G415_RS0100535 amino acid ABC transporter permease
Query= TCDB::A1VZQ3 (250 letters) >NCBI__GCF_000420385.1:WP_022669622.1 Length = 313 Score = 135 bits (339), Expect = 1e-36 Identities = 65/197 (32%), Positives = 117/197 (59%), Gaps = 1/197 (0%) Query: 47 GFIYTLEVSILALLIATIFGTIGGVMATSRFKIIRAYTRIYVELFQNVPLVIQIFFLFYA 106 G T++VS++++++A I G I G+M S + R + +Y+E+ + PL++QIF +++ Sbjct: 114 GLYMTIKVSVVSIIMALIIGFIAGLMRISENPLFRNLSVVYIEIIRGTPLLVQIFIVYFF 173 Query: 107 LPVLGIRLDIFTIGVLGVGAYHGAYVSEVVRSGILAVPRGQFEASASQGFTYIQQMRYII 166 + + + F G + + GAY++E++R+GI ++PRGQ EAS + G Y Q MRYII Sbjct: 174 VGTI-FNMTRFFAGAFALAVFEGAYIAEIIRAGIQSIPRGQTEASLALGMNYFQIMRYII 232 Query: 167 VPQTIRIILPPMTNQMVNLIKNTSVLLIVGGAELMHSADSYAADYGNYAPAYIFAAVLYF 226 +PQ I+ +LP + Q ++LIK++S+L ++ EL + + + + A LYF Sbjct: 233 MPQAIKRVLPALAGQFISLIKDSSLLSVISLTELTKAGREIVSSTFSPFEIWFSVAALYF 292 Query: 227 IICYPLAYFAKAYENKL 243 I+ Y L+ + E +L Sbjct: 293 IVTYSLSLLDRYLERRL 309 Lambda K H 0.328 0.143 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 313 Length adjustment: 26 Effective length of query: 224 Effective length of database: 287 Effective search space: 64288 Effective search space used: 64288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory