Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_022670152.1 G415_RS0103225 phosphate ABC transporter ATP-binding protein PstB
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_000420385.1:WP_022670152.1 Length = 251 Score = 129 bits (323), Expect = 7e-35 Identities = 85/248 (34%), Positives = 130/248 (52%), Gaps = 18/248 (7%) Query: 1 MIELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVV 60 ++ +KN+N +YG +L NIN+ + + +IGPSG GK+T +RC N + ++ G Sbjct: 5 LLSVKNLNFFYGKTQILHNINMDIYKNRITALIGPSGCGKTTFLRCFNRMHDLYKGNRYE 64 Query: 61 NNLVLNHKNKIEI-----CRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEET 115 ++ +N +++ R MVFQ +P M++ N+ K K E Sbjct: 65 GEILYKGENILKVKDLIELRSKIGMVFQKPTPFP-MSIFDNVAYGLKLKGIKDKNIIRER 123 Query: 116 AFKYLKVVGLLD--KANVYPA--TLSGGQQQRVAIARSLCTKKPYILFDEPTSALDP--- 168 K L L D K +Y + LSGGQQQR+ IAR+L + ILFDEPTSALDP Sbjct: 124 VEKALIEAALWDEVKDKLYSSALALSGGQQQRMVIARALAVEPDIILFDEPTSALDPIAT 183 Query: 169 ETIQEVLDVMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPK 228 I+E+L +K+I TT+++VTH M A V+D F+ G ++E + F+NPK Sbjct: 184 SKIEELLFNLKKI-----TTILIVTHNMQQAARVSDFTAFLFKGHLIEFERTEKLFTNPK 238 Query: 229 TERARLFL 236 E ++ Sbjct: 239 EELTEKYI 246 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 251 Length adjustment: 24 Effective length of query: 218 Effective length of database: 227 Effective search space: 49486 Effective search space used: 49486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory