Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_022669727.1 G415_RS0101055 nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein
Query= TCDB::Q97UF2 (371 letters) >NCBI__GCF_000420385.1:WP_022669727.1 Length = 424 Score = 139 bits (350), Expect = 1e-37 Identities = 81/206 (39%), Positives = 124/206 (60%), Gaps = 14/206 (6%) Query: 1 MTTIRVENLSKIFKKGKTE-VKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEP 59 M I++EN++ IF K+E + ++N+S++I+ G +LGPSG GK+T LR+I GL +P Sbjct: 1 MEIIKLENINMIFPISKSESLTVLENISLSIEEGKIVSILGPSGCGKSTLLRIITGLLKP 60 Query: 60 TSGYIYFDNEAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKI 119 T G +++ + S M AMVFQN+AL+P TV+DNIA ++ ++ Sbjct: 61 TKGKVFYKGKVQSGVNDKM--------AMVFQNFALFPWKTVWDNIAIGIRNREIRNK-- 110 Query: 120 ENKVKEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRE 179 + +K V + +GL G + YPK LSGG QR IARALV +P++L +DEPFS LD E Sbjct: 111 DEMIKRVIDIVGLEGFEDVYPKSLSGGMKQRVGIARALVSNPEILCMDEPFSALDVLTAE 170 Query: 180 SARALVRKIQRERKLT---TLIVSHD 202 + R + + RK + +IV+H+ Sbjct: 171 NLREELMDLWLSRKTSLKGIVIVTHN 196 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 424 Length adjustment: 31 Effective length of query: 340 Effective length of database: 393 Effective search space: 133620 Effective search space used: 133620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory