Align ABC transporter for L-Histidine, periplasmic substrate-binding component 1 (characterized)
to candidate WP_022669621.1 G415_RS0100530 transporter substrate-binding domain-containing protein
Query= reanno::acidovorax_3H11:Ac3H11_2555 (249 letters) >NCBI__GCF_000420385.1:WP_022669621.1 Length = 274 Score = 116 bits (290), Expect = 5e-31 Identities = 75/225 (33%), Positives = 121/225 (53%), Gaps = 8/225 (3%) Query: 28 VLRVGTDATFPPMEF-VENGKRTGFDIELVEAIAKTMGKQVEWVDIDFKGLIPGLISKRF 86 VLRVG +A + P E + GK GFD++L + +AK MG +++ V+ D+ G+IP L++ +F Sbjct: 42 VLRVGLNAGYMPFEMRSKTGKIIGFDVDLAKLMAKAMGVKLQIVNTDWDGIIPSLMTGKF 101 Query: 87 DMAVSAIYITDERKKVVDFTDSYYAGGLVVMV-KADNKAINKLADLDGKK--VSVQVGTK 143 D+ +S + IT +R V+F D Y G +++ K + DL+ K ++V +GT Sbjct: 102 DIIMSGMTITQKRNLKVNFADPYIVVGQTILLNKKWAGKVKSYKDLNSPKFTITVMLGTT 161 Query: 144 SVSYLTEKF-PKVQRVEVEKNQEMFNLVDIGRADAAVTGKP--AAFQYVRTRPGLRVLDE 200 + +KF PK + E + +E V GRADA + KP + F + + L LD+ Sbjct: 162 G-DFAAKKFMPKAKIEEFQTEEEAVMQVVQGRADAFIYDKPYNSIFYATKGKGKLIFLDK 220 Query: 201 QLTTEEYGMALRKDTPELTKAVNGAITKLKADGTYAAIVKKWFSN 245 T E G A+ K P+ +N + ++K DG Y + KWF N Sbjct: 221 PFTYEPLGWAINKGDPDFLNWLNNFLRQIKHDGEYQKLYNKWFVN 265 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 274 Length adjustment: 25 Effective length of query: 224 Effective length of database: 249 Effective search space: 55776 Effective search space used: 55776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory