Align Histidine transport system permease protein HisM (characterized)
to candidate WP_022669622.1 G415_RS0100535 amino acid ABC transporter permease
Query= SwissProt::P0A2I7 (235 letters) >NCBI__GCF_000420385.1:WP_022669622.1 Length = 313 Score = 104 bits (260), Expect = 2e-27 Identities = 63/206 (30%), Positives = 108/206 (52%), Gaps = 11/206 (5%) Query: 22 GVAITLWLLISSVVMGGLLAVILAVGRVSSNKFIRFPIWLFTYIFRGTPLYVQLLVFYSG 81 G+ +T+ + + S++M ++ I + R+S N R ++ I RGTPL VQ+ + Y Sbjct: 114 GLYMTIKVSVVSIIMALIIGFIAGLMRISENPLFRNLSVVYIEIIRGTPLLVQIFIVYFF 173 Query: 82 MYTLEIVKGTDLLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGF 141 + T+ F + AL + AY EI I+S+P G+ EA+ A G Sbjct: 174 VGTI-----------FNMTRFFAGAFALAVFEGAYIAEIIRAGIQSIPRGQTEASLALGM 222 Query: 142 SSFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINSATYQPFT 201 + F++ R II+P A++ LPA + + I ++ ++L ++ +L K R+I S+T+ PF Sbjct: 223 NYFQIMRYIIMPQAIKRVLPALAGQFISLIKDSSLLSVISLTELTKAGREIVSSTFSPFE 282 Query: 202 AFGIAAVLYLLISYVLISLFRRAERR 227 + A LY +++Y L L R ERR Sbjct: 283 IWFSVAALYFIVTYSLSLLDRYLERR 308 Lambda K H 0.330 0.141 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 235 Length of database: 313 Length adjustment: 25 Effective length of query: 210 Effective length of database: 288 Effective search space: 60480 Effective search space used: 60480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory