Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_022669997.1 G415_RS0102410 ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_000420385.1:WP_022669997.1 Length = 252 Score = 172 bits (437), Expect = 5e-48 Identities = 90/252 (35%), Positives = 150/252 (59%), Gaps = 2/252 (0%) Query: 15 ESSLLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGE 74 ++ +L + +SKSFGG++AV++ VKE I LIGPNGAGKTTLFN+++ + D G Sbjct: 3 KTPILNIKSISKSFGGIKAVENVSFTVKEKQIKALIGPNGAGKTTLFNIITGLYKADNGS 62 Query: 75 VLFNGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFR 134 V F G I P+++ G RTFQ ++ LTVLEN+ + + + F+ Sbjct: 63 VEFLGSDILSKKPYELVKLGIARTFQNIQLSEELTVLENVAIGMDFKKRTGLFEMM--FK 120 Query: 135 RVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPA 194 + E+ ++A +L + + A Y+ + G ++L+E+ARA++S+PKL+LLDEPA Sbjct: 121 PSKPTEKQKLKEAFKVLSFLKIEEFAYKYSNEIPFGVKRLVELARAMVSSPKLLLLDEPA 180 Query: 195 AGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQIQ 254 AG+N + + I +G++ L+IEH+++ + H + V+ G+ +A+G P ++ Sbjct: 181 AGLNEKETDNLLKAIFRIWEKGVSILLIEHDIEFVSNCSHSIVVMDSGKKIAEGLPSEVL 240 Query: 255 SDPRVLEAYLGD 266 +D RV+ AYLGD Sbjct: 241 NDERVMRAYLGD 252 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 252 Length adjustment: 24 Effective length of query: 243 Effective length of database: 228 Effective search space: 55404 Effective search space used: 55404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory