Align 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate WP_022669656.1 G415_RS0100700 acyl-CoA dehydrogenase family protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_1146 (375 letters) >NCBI__GCF_000420385.1:WP_022669656.1 Length = 379 Score = 214 bits (544), Expect = 4e-60 Identities = 122/371 (32%), Positives = 200/371 (53%), Gaps = 4/371 (1%) Query: 4 TEEQTQIRDMARQFAEERLKPFAAEWDREHRFPREAIDEMAELGFFGMLVPEQWGGCDTG 63 TEEQ R +F E+++KP E + + E ++ + + G+ +P+++ G G Sbjct: 7 TEEQEIFRKKVAEFTEKKIKPKVREMEEKKVALPEVVEALKDEKLTGIFIPKEYNGLGLG 66 Query: 64 YLAYAMTLEEIAAGDGACSTIMSVHNSVGCVPILKFGNDEQKAKFLTPLASGAMLGAFAL 123 Y + LEEIA + ++ + +G PILKFGNDEQK K+L LA G L A+ Sbjct: 67 YTERLIALEEIAKVSPGVAMMLQIFG-LGIEPILKFGNDEQKQKYLPGLAVGEKLATVAV 125 Query: 124 TEPQAGSDASSLKTRARLEGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRGISAFI 183 TE GSD + +KT + EGD Y+LNG K +T+ A +V A S + S I Sbjct: 126 TEATGGSDPTGIKTTYKKEGDFYILNGRKIMLTNAPIANTFVVLA--KDSENPKAFSTLI 183 Query: 184 VPTDSPGYSVARVEDKLGQHASDTCQILFEDLKVPVGNRLGEEGEGYKIALANL-EGGRV 242 + G+ + ++G H +IL E+ KVP N LG+EG+G ++A++ + E GR Sbjct: 184 IEDTFEGFRRGKEWHEIGLHGCSVGEILLENCKVPASNLLGQEGKGMRVAMSAIGEVGRG 243 Query: 243 GIAAQAVGMARAAFEAARDYARERSSFGKPIIEHQAVAFRLADMATQIAVARQMVHYAAA 302 G+ A+G+ + +++++R +GKPI Q + ++A+M + + R + + A + Sbjct: 244 GMVGVALGIMDTLLKITVNFSKKRILYGKPISNLQTIQNKIAEMRLDLEIGRLLGYRATS 303 Query: 303 LRDSGQPALVEASMAKLFASEMAEKVCSMALQTLGGYGYLNDFPLERIYRDVRVCQIYEG 362 ++D GQ + +E +MAK F +E A+K MA+ GGYG + + R RD V G Sbjct: 304 IQDKGQRSDLEFAMAKYFTTEAAQKAAKMAVDIQGGYGVTEEAVVTRFLRDSFVLGPSAG 363 Query: 363 TSDIQRMVISR 373 TSDI +++I+R Sbjct: 364 TSDIMKVIIAR 374 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 379 Length adjustment: 30 Effective length of query: 345 Effective length of database: 349 Effective search space: 120405 Effective search space used: 120405 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory