Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_022669998.1 G415_RS0102415 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQH9 (318 letters) >NCBI__GCF_000420385.1:WP_022669998.1 Length = 308 Score = 179 bits (453), Expect = 1e-49 Identities = 99/297 (33%), Positives = 176/297 (59%), Gaps = 15/297 (5%) Query: 16 LAGYSLISVLVSVGVL--NLFYVQILQQIGINIILAVGLNLIVGFSGQFSLGHAGFMAIG 73 +A S ++ ++G+L N F + +L +++I+ +GL+L++GF+GQ SLGHAGF+A+G Sbjct: 5 IAYISFFVLMFAIGILIKNPFILNMLSIAALSVIVILGLDLLMGFAGQVSLGHAGFVAMG 64 Query: 74 AYAAAIIGSKSPTYGAFFGAMLVGALLSGAVALLVGIPTLRLKGDYLAVATLGVSEIIRI 133 AY ++++ K A+L+ L++ +A ++ PT++LKG YLA+ATL + EI+ I Sbjct: 65 AYISSLLSIKLNINPWL--AILIAVLITSLLASIIAYPTMKLKGHYLAMATLAIGEIVYI 122 Query: 134 FIINGGSLTNGAAGILGIP-----NFTT------WQMVYFFVVITTIATLNFLRSPIGRS 182 + N SLT G G+ G+P NF + +V+ V + T +N S GRS Sbjct: 123 LLNNLTSLTGGHQGLSGMPMLSIGNFVFDSDKKFYFLVWLIVSVITFIIVNITNSSFGRS 182 Query: 183 TLSVREDEIAAESVGVNTTKIKIIAFVFGAITASIAGSLQAGFIGSVVPKDYTFINSINV 242 ++E E AA S G+N +KI+ F A AS+AG L A ++G + P ++ + SI+ Sbjct: 183 LRLIKEKEPAAVSFGINAHMLKIVVFTISATLASLAGGLFAFYLGFISPASFSLLKSIDY 242 Query: 243 LIIVVFGGLGSITGAIVSAIVLGILNMLLQDVASVRMIIYALALVLVMIFRPGGLLG 299 +++V GG+G++ G ++ +++L +L +L + I+ + LV++++F P G+ G Sbjct: 243 VVMVFVGGMGTVIGPMIMSVILTVLPNILLSLQEFWPIVNGILLVVMVMFLPEGIGG 299 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 308 Length adjustment: 27 Effective length of query: 291 Effective length of database: 281 Effective search space: 81771 Effective search space used: 81771 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory