Align Basic amino acid uptake transporter, BgtAB (characterized)
to candidate WP_022669622.1 G415_RS0100535 amino acid ABC transporter permease
Query= TCDB::Q8YSA2 (501 letters) >NCBI__GCF_000420385.1:WP_022669622.1 Length = 313 Score = 165 bits (418), Expect = 2e-45 Identities = 91/203 (44%), Positives = 132/203 (65%), Gaps = 7/203 (3%) Query: 283 LLQGALVTIQLTILSTVLGLICGTLIALTRLSQFTPARLFARAYVDFFRGTPLLVQIFMI 342 LL G +TI+++++S ++ LI G + L R+S+ R + Y++ RGTPLLVQIF++ Sbjct: 111 LLMGLYMTIKVSVVSIIMALIIGFIAGLMRISENPLFRNLSVVYIEIIRGTPLLVQIFIV 170 Query: 343 YFGIPALAQQLGFTFNFDRWVAGVIALSVNAAAYIAEIVRAGIQSIETGQTEAAKSLGLN 402 YF + G FN R+ AG AL+V AYIAEI+RAGIQSI GQTEA+ +LG+N Sbjct: 171 YFFV-------GTIFNMTRFFAGAFALAVFEGAYIAEIIRAGIQSIPRGQTEASLALGMN 223 Query: 403 PWLTMRLVIFPQAFRRMLPPLGNEFISLLKDTSLVAVIGFEELFRKGQLIVADNYRAFEI 462 + MR +I PQA +R+LP L +FISL+KD+SL++VI EL + G+ IV+ + FEI Sbjct: 224 YFQIMRYIIMPQAIKRVLPALAGQFISLIKDSSLLSVISLTELTKAGREIVSSTFSPFEI 283 Query: 463 YAAVAIVYLCLTLLASQVLSRLE 485 + +VA +Y +T S + LE Sbjct: 284 WFSVAALYFIVTYSLSLLDRYLE 306 Lambda K H 0.323 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 501 Length of database: 313 Length adjustment: 31 Effective length of query: 470 Effective length of database: 282 Effective search space: 132540 Effective search space used: 132540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory