Align ABC transporter for L-Lysine, permease component 1 (characterized)
to candidate WP_022669622.1 G415_RS0100535 amino acid ABC transporter permease
Query= reanno::pseudo6_N2E2:Pf6N2E2_2959 (242 letters) >NCBI__GCF_000420385.1:WP_022669622.1 Length = 313 Score = 127 bits (319), Expect = 3e-34 Identities = 70/215 (32%), Positives = 123/215 (57%), Gaps = 13/215 (6%) Query: 20 GPLLMQGTWMTIKLSALSLLLSVLLGLLGASAKLSSVKLLRIPAQLYTTLIRGVPDLVLM 79 GPLLM G +MTIK+S +S+++++++G + ++S L R + +Y +IRG P LV + Sbjct: 109 GPLLM-GLYMTIKVSVVSIIMALIIGFIAGLMRISENPLFRNLSVVYIEIIRGTPLLVQI 167 Query: 80 LLIFYSLQTWLTSLTDFMEWEYIEIDPFGAGVITLGFIYGAYFTETFRGAILSVPRGQVE 139 ++++ + T + ++T F AG L GAY E R I S+PRGQ E Sbjct: 168 FIVYFFVGT-IFNMTRFF-----------AGAFALAVFEGAYIAEIIRAGIQSIPRGQTE 215 Query: 140 AATAYGLKRGQRFRFVVFPQMMRFALPGIGNNWMVMLKATALVSIIGLADLVKAAQDAGK 199 A+ A G+ Q R+++ PQ ++ LP + ++ ++K ++L+S+I L +L KA ++ Sbjct: 216 ASLALGMNYFQIMRYIIMPQAIKRVLPALAGQFISLIKDSSLLSVISLTELTKAGREIVS 275 Query: 200 STYQLFYFLVLAALIYLLITSASNFILRWLERRYA 234 ST+ F A +Y ++T + + + R+LERR A Sbjct: 276 STFSPFEIWFSVAALYFIVTYSLSLLDRYLERRLA 310 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 313 Length adjustment: 25 Effective length of query: 217 Effective length of database: 288 Effective search space: 62496 Effective search space used: 62496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory