Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_022670625.1 G415_RS0105555 ABC transporter ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >NCBI__GCF_000420385.1:WP_022670625.1 Length = 326 Score = 323 bits (827), Expect = 5e-93 Identities = 160/327 (48%), Positives = 221/327 (67%), Gaps = 14/327 (4%) Query: 10 MKPLLQTVDLKK-----------YFPQGKRILKAVDGISIEIKEGETLGLVGESGCGKST 58 M+ +L+ +LKK +F + K +KAVD +S I++GETLG+VGESG GK+T Sbjct: 1 MEKILEVKNLKKEFELKGSWLASFFSKDKPTVKAVDDVSFSIRKGETLGIVGESGSGKTT 60 Query: 59 LGRTILKLLRPDGGKIFFEGKDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIE 118 LGRT+L+L P G I F+GKD+ L E++ RK QIIFQDP+ SLNP M +G+I+ Sbjct: 61 LGRTVLRLTEPTAGSIIFKGKDLAKLPKSELRKERKNFQIIFQDPMASLNPYMRIGKIVS 120 Query: 119 DPLIIHKIGTKKERRKRVEELLDMVGI--GREFINSFPHEFSGGQQQRIGIARALALNPK 176 PL IH IGTK ER++R+ EL + + + EF N FP SGGQ+QR+ IARAL NP+ Sbjct: 121 HPLEIHNIGTKNERKERILELFEKINLSPAEEFYNRFPKHLSGGQRQRVVIARALITNPE 180 Query: 177 FIVCDEPVSALDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIV 236 FIV DEP + LDVS+++QI+ L+ ++++ G++YLFI H+LA ++I ++ VMYLGKIV Sbjct: 181 FIVADEPTAMLDVSVRSQILKLMIDVKETFGLTYLFITHDLASAKYICDRIGVMYLGKIV 240 Query: 237 EYGDVDKIFLNPIHPYTRALLKSVPKIPWDGQKQRFYSLKGELPSPIDLPKGCRFQTRCT 296 E +F P+HPYT+ L+ SVP IP ++ KGE+PS +P GCRF TRC Sbjct: 241 EIAKTFDLFKEPLHPYTKILMSSVP-IPDPNIRREKLLPKGEIPSATKIPSGCRFHTRCP 299 Query: 297 EKKAICFEKEPELTEVEKNHFVSCHLV 323 K IC +KEPEL E+EK+ FV+CHL+ Sbjct: 300 FAKEICSQKEPELKEIEKDRFVACHLI 326 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 326 Length adjustment: 28 Effective length of query: 300 Effective length of database: 298 Effective search space: 89400 Effective search space used: 89400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory