Align Cyclohex-1-ene-1-carbonyl-CoA dehydrogenase; Ch1CoA; EC 1.3.8.10 (characterized)
to candidate WP_022669656.1 G415_RS0100700 acyl-CoA dehydrogenase family protein
Query= SwissProt::Q2LQN9 (414 letters) >NCBI__GCF_000420385.1:WP_022669656.1 Length = 379 Score = 196 bits (497), Expect = 1e-54 Identities = 125/375 (33%), Positives = 193/375 (51%), Gaps = 5/375 (1%) Query: 38 TEEQKLLMEMVRNLAVREIAPRAIEIDENHSFPVHARDLFADLGLLSPLVPVEYGGTGMD 97 TEEQ++ + V ++I P+ E++E + D L +P EY G G+ Sbjct: 7 TEEQEIFRKKVAEFTEKKIKPKVREMEEKKVALPEVVEALKDEKLTGIFIPKEYNGLGLG 66 Query: 98 ITTFAMVLEEIGKVCASTALMLLAQADGMLSIILDGSPALKEKYLPRFGEKSTLMTAFAA 157 T + LEEI KV A+ML G+ I+ G+ K+KYLP L T A Sbjct: 67 YTERLIALEEIAKVSPGVAMMLQIFGLGIEPILKFGNDEQKQKYLPGLAVGEKLATV-AV 125 Query: 158 TEPGAGSDLLAMKTRAVKKGDKYVINGQKCFITNGSVADILTVWAYTDPSKGAKGMSTFV 217 TE GSD +KT K+GD Y++NG+K +TN +A+ V A S+ K ST + Sbjct: 126 TEATGGSDPTGIKTTYKKEGDFYILNGRKIMLTNAPIANTFVVLA--KDSENPKAFSTLI 183 Query: 218 VERGTPGLIYGHNEKKMGMRGCPNSELFFEDLEVPAENLVGEEGKGFAYLMGAL-SINRV 276 +E G G ++G+ GC E+ E+ +VPA NL+G+EGKG M A+ + R Sbjct: 184 IEDTFEGFRRGKEWHEIGLHGCSVGEILLENCKVPASNLLGQEGKGMRVAMSAIGEVGRG 243 Query: 277 FCASQAVGIAQGALERAMQHTREREQFGKPIAHLTPIQFMIADMATEVEAARLLVRKATT 336 A+GI L+ + +++R +GKPI++L IQ IA+M ++E RLL +AT+ Sbjct: 244 GMVGVALGIMDTLLKITVNFSKKRILYGKPISNLQTIQNKIAEMRLDLEIGRLLGYRATS 303 Query: 337 LLDAKDKRGPLIGGMAKTFASDTAMKVTTDAVQVMGGSGYMQEYQVERMMREAKLTQIYT 396 + D K +R L MAK F ++ A K AV + GG G +E V R +R++ + Sbjct: 304 IQD-KGQRSDLEFAMAKYFTTEAAQKAAKMAVDIQGGYGVTEEAVVTRFLRDSFVLGPSA 362 Query: 397 GTNQITRMVTGRSLL 411 GT+ I +++ R+ + Sbjct: 363 GTSDIMKVIIARATI 377 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 414 Length of database: 379 Length adjustment: 31 Effective length of query: 383 Effective length of database: 348 Effective search space: 133284 Effective search space used: 133284 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory