Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate WP_022671061.1 G415_RS0107505 ABC transporter ATP-binding protein
Query= CharProtDB::CH_003736 (237 letters) >NCBI__GCF_000420385.1:WP_022671061.1 Length = 233 Score = 244 bits (622), Expect = 1e-69 Identities = 127/232 (54%), Positives = 166/232 (71%), Gaps = 1/232 (0%) Query: 5 MLSFDKVSAHYGKIQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRIVF 64 ML+ ++ +YG I A+ +S + G+IVTLIGANGAGK++ L ++ G + G+I+F Sbjct: 1 MLTVKDLNVYYGVIHAVKGISFEVPNGKIVTLIGANGAGKSSTLKSIAGLVKP-KGKILF 59 Query: 65 DDKDITDWQTAKIMREAVAIVPEGRRVFSRMTVEENLAMGGFFAERDQFQERIKWVYELF 124 DKDI+ Q KI R +A+VPEGRRVF +T+ ENL MGGF + + + + ++ELF Sbjct: 60 KDKDISKTQAYKISRMGIALVPEGRRVFVNLTILENLRMGGFNKKHSELEPLYEKMFELF 119 Query: 125 PRLHERRIQRAGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTIEQLR 184 P L ER Q+AGT+SGGEQQMLAI RALMS P LL+LDEPSLGLAP+I+ ++FD +++L Sbjct: 120 PILKERAHQKAGTLSGGEQQMLAIARALMSEPELLMLDEPSLGLAPLIVSEVFDILKELN 179 Query: 185 EQGMTIFLVEQNANQALKLADRGYVLENGHVVLSDTGDALLANEAVRSAYLG 236 +QG TI LVEQNA QAL+LAD GYVLENG + L LL NE VR AYLG Sbjct: 180 KQGKTILLVEQNAAQALQLADYGYVLENGQITLEGDAKELLENEDVRKAYLG 231 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 233 Length adjustment: 23 Effective length of query: 214 Effective length of database: 210 Effective search space: 44940 Effective search space used: 44940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory