Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate WP_022671302.1 G415_RS0108700 branched-chain amino acid ABC transporter permease
Query= uniprot:G8ALI9 (505 letters) >NCBI__GCF_000420385.1:WP_022671302.1 Length = 288 Score = 164 bits (415), Expect = 4e-45 Identities = 102/300 (34%), Positives = 163/300 (54%), Gaps = 31/300 (10%) Query: 172 LLDIGILLLTYIMLGWGLNIVVGLAGLLDLGYVAFYAVGAYSYALLAHYFGFSFWVCLPL 231 L+ IGI YI+L LNI+VG +G + LG+ AF+A+GAYS+A+L + F L Sbjct: 9 LITIGI----YIILSLSLNILVGYSGQVSLGHAAFWAIGAYSFAILTTRYSVGFIEASML 64 Query: 232 AGFLAAMSGVLLGFPVLRLRGDYFAIVTLGFGEIIRIILINWYQFTGGPNGISGIPRPSF 291 + + G++LG P LRL D+ I T+G I+ I N + + GG GI IP P+ Sbjct: 65 SVLITTFVGIILGLPSLRLSEDFLVITTIGINFIVEGIF-NTFNYFGGAMGIGNIPFPTI 123 Query: 292 FGIADFTRTPAEGTAAFHEMFGLEFSPLHRIIFLYYLILVLALVVN-LFTMRVRKLPLGR 350 G +++F L + Y +VL ++++ LF + G Sbjct: 124 -----------NGHMISNQVFAL----------IVYTAVVLTIIISYLFKLSWS----GL 158 Query: 351 AWEALREDDIACASLGINRTNMKLAAFAIAAMFGGFAGSFFATRQGFISPESFTFIESAI 410 A A+++D++A G++ K+ AFA+++ G +G +A+ GFIS F+F S Sbjct: 159 ACSAIKDDELAADVSGVSVVKFKMIAFALSSALAGLSGILYASFMGFISAADFSFPVSVT 218 Query: 411 ILAIVVLGGMGSQIGVVVAAFLVIGLPEAFRELADYRMLAFGMGMVLIMLWRPRGLLAHR 470 ILA+V++GG G+ IG + A L++ LPE FR + DYRML +G+ +VL+M ++P G + Sbjct: 219 ILAMVMVGGEGTIIGPIFGAALLVLLPELFRPIHDYRMLLYGLLIVLMMRFQPDGFFGRK 278 Lambda K H 0.329 0.144 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 505 Length of database: 288 Length adjustment: 30 Effective length of query: 475 Effective length of database: 258 Effective search space: 122550 Effective search space used: 122550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory