Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_022669996.1 G415_RS0102405 ABC transporter ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >NCBI__GCF_000420385.1:WP_022669996.1 Length = 237 Score = 167 bits (424), Expect = 1e-46 Identities = 90/238 (37%), Positives = 149/238 (62%), Gaps = 5/238 (2%) Query: 5 ILKVQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHI 64 +LKV+ L V YG A+K I+LE+ E+V +IG+NGAGKTT L AI + S+ G + Sbjct: 1 MLKVENLVVKYGEAIALKEINLEIKANEIVAVIGSNGAGKTTLLNAIMNRVKKSK--GRV 58 Query: 65 EYLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYTS-DDKG--QIAADID 121 + + K+ ++ ++ +P+ R V +++++NL++ Y KG ++ Sbjct: 59 FFKNIEITNLKTHKIANLGISYLPDKRTVIKELTVKDNLMIAGYNQIKTKGFTYFNDKLE 118 Query: 122 KWFAVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIFE 181 F FP +K + Q AG LSGGEQQML++A+AL+ P+L++LDEP+ GLSP +V+ +FE Sbjct: 119 ALFEHFPNIKTKIKQKAGLLSGGEQQMLSLAQALLREPELIILDEPTAGLSPKLVKTVFE 178 Query: 182 VIRNVSAQGITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQMLDDPRVKAAYLG 239 +I + G++IL+VEQN ++AA Y++++G IT +G++++ D R+K AY G Sbjct: 179 IISFIKKNGLSILIVEQNVNKTIDAADEVYILKNGKITDKGKSKEFKDGFRLKQAYFG 236 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 237 Length adjustment: 23 Effective length of query: 218 Effective length of database: 214 Effective search space: 46652 Effective search space used: 46652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory