Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_022669997.1 G415_RS0102410 ABC transporter ATP-binding protein
Query= TCDB::P21629 (255 letters) >NCBI__GCF_000420385.1:WP_022669997.1 Length = 252 Score = 192 bits (487), Expect = 7e-54 Identities = 96/251 (38%), Positives = 162/251 (64%), Gaps = 3/251 (1%) Query: 4 PILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGLIR 63 PIL + ++ FGG+ AV V+ V+EKQ+ ++IGPNGAGKTT+FN +TG Y+ G + Sbjct: 5 PILNIKSISKSFGGIKAVENVSFTVKEKQIKALIGPNGAGKTTLFNIITGLYKADNGSVE 64 Query: 64 LDGEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKTPAF 123 G +I +++ + G+ RTFQN++L +E+T +EN+ + T +FK Sbjct: 65 FLGSDILSKKPYELVKLGIARTFQNIQLSEELTVLENVAIGMDFKKRTGLFEMMFKPS-- 122 Query: 124 RRSEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDEPAAG 183 + +E++ ++ A L + + EFA + + + +G +R +E+AR M++ P++L+LDEPAAG Sbjct: 123 KPTEKQKLKEAFKVLSFLKIEEFAYKYSNEIPFGVKRLVELARAMVSSPKLLLLDEPAAG 182 Query: 184 LNPKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQIRD 243 LN KETD+L I ++ E V++LLIEHD++ V + S IVV++ G +A+G P ++ + Sbjct: 183 LNEKETDNLLKAIFRI-WEKGVSILLIEHDIEFVSNCSHSIVVMDSGKKIAEGLPSEVLN 241 Query: 244 NPDVIKAYLGE 254 + V++AYLG+ Sbjct: 242 DERVMRAYLGD 252 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 252 Length adjustment: 24 Effective length of query: 231 Effective length of database: 228 Effective search space: 52668 Effective search space used: 52668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory