Align Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial; SBCAD; 2-methyl branched chain acyl-CoA dehydrogenase; 2-MEBCAD; 2-methylbutyryl-coenzyme A dehydrogenase; 2-methylbutyryl-CoA dehydrogenase; EC 1.3.8.5 (characterized)
to candidate WP_022669656.1 G415_RS0100700 acyl-CoA dehydrogenase family protein
Query= SwissProt::P45954 (432 letters) >NCBI__GCF_000420385.1:WP_022669656.1 Length = 379 Score = 209 bits (533), Expect = 9e-59 Identities = 122/373 (32%), Positives = 204/373 (54%), Gaps = 5/373 (1%) Query: 56 TFTDEEMMIKSSVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVDPEYGGTG 115 TFT+E+ + + V +F +++I P V M+E V++ L + L GI + EY G G Sbjct: 5 TFTEEQEIFRKKVAEFTEKKIKPKVREMEEKKVALPEVVEALKDEKLTGIFIPKEYNGLG 64 Query: 116 ASFLSTVLVIEELAKVDASVAVFCEIQNTLINTLIRKHGTEEQKATYLPQLTT-EKVGSF 174 + ++ +EE+AKV VA+ +I I ++ K G +EQK YLP L EK+ + Sbjct: 65 LGYTERLIALEEIAKVSPGVAMMLQIFGLGIEPIL-KFGNDEQKQKYLPGLAVGEKLATV 123 Query: 175 CLSEAGAGSDSFALKTRADKEGDYYVLNGSKMWISSAEHAGLFLVMANVDPTIGYKGITS 234 ++EA GSD +KT KEGD+Y+LNG K+ +++A A F+V+A + K ++ Sbjct: 124 AVTEATGGSDPTGIKTTYKKEGDFYILNGRKIMLTNAPIANTFVVLAK--DSENPKAFST 181 Query: 235 FLVDRDTPGLHIGKPENKLGLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNE-G 293 +++ G GK +++GL S + EN KVP +N+LGQ G G + A+ ++ E G Sbjct: 182 LIIEDTFEGFRRGKEWHEIGLHGCSVGEILLENCKVPASNLLGQEGKGMRVAMSAIGEVG 241 Query: 294 RIGIAAQMLGLAQGCFDYTIPYIKERIQFGKRLFDFQGLQHQVAHVATQLEAARLLTYNA 353 R G+ LG+ T+ + K+RI +GK + + Q +Q+++A + LE RLL Y A Sbjct: 242 RGGMVGVALGIMDTLLKITVNFSKKRILYGKPISNLQTIQNKIAEMRLDLEIGRLLGYRA 301 Query: 354 ARLLEAGKPFIKEASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIY 413 + + G+ E +MAKY+ +E A + ++ GG G T++ V ++ RD+ + Sbjct: 302 TSIQDKGQRSDLEFAMAKYFTTEAAQKAAKMAVDIQGGYGVTEEAVVTRFLRDSFVLGPS 361 Query: 414 EGASNIQLNTIAK 426 G S+I IA+ Sbjct: 362 AGTSDIMKVIIAR 374 Lambda K H 0.318 0.134 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 379 Length adjustment: 31 Effective length of query: 401 Effective length of database: 348 Effective search space: 139548 Effective search space used: 139548 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory