Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate WP_022669727.1 G415_RS0101055 nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >NCBI__GCF_000420385.1:WP_022669727.1 Length = 424 Score = 132 bits (332), Expect = 2e-35 Identities = 88/225 (39%), Positives = 129/225 (57%), Gaps = 18/225 (8%) Query: 19 VLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGTLRIGGTV---VNDLPARE 75 VL + L I +G+ V +LGPSGCGKST+LR+I GL + G + G V VND Sbjct: 23 VLENISLSIEEGKIVSILGPSGCGKSTLLRIITGLLKPTKGKVFYKGKVQSGVND----- 77 Query: 76 RNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAALLNLEALLERKPRAM 135 +AMVFQN+AL+P +V+DNIA G+R R D ++ V ++ LE + P+++ Sbjct: 78 -KMAMVFQNFALFPWKTVWDNIAIGIRN--REIRNKDEMIKRVIDIVGLEGFEDVYPKSL 134 Query: 136 SGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRLHQRLRTT---TVYVT 192 SGG +QR IARA++ P + DEP S LD LR ++ L +T+ V VT Sbjct: 135 SGGMKQRVGIARALVSNPEILCMDEPFSALDVLTAENLREELMDLWLSRKTSLKGIVIVT 194 Query: 193 HDQLEAMTLADRVILM--QDGRIVQAGSPAELYRYPRNLFAAGFI 235 H+ EA+ ++D +I+M + GR VQ +L YPR+ +A F+ Sbjct: 195 HNITEAVYMSDEIIIMASRPGR-VQLVYKNKL-SYPRDQNSADFL 237 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 259 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 424 Length adjustment: 31 Effective length of query: 375 Effective length of database: 393 Effective search space: 147375 Effective search space used: 147375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory