Align ABC transporter for D-Alanine, ATPase component (characterized)
to candidate WP_084516821.1 H567_RS0103445 phosphate ABC transporter ATP-binding protein PstB
Query= reanno::pseudo6_N2E2:Pf6N2E2_5405 (254 letters) >NCBI__GCF_000422285.1:WP_084516821.1 Length = 271 Score = 129 bits (325), Expect = 5e-35 Identities = 81/255 (31%), Positives = 140/255 (54%), Gaps = 19/255 (7%) Query: 9 VSPEGIIQMQGVNKWYGQFHVLKDINLNVKQGERIVLCGPSGSGKSTTIRCLNRLEE--- 65 + E +Q++G++ +YG FH L+ I+L+ + L GPSG GKST +RCLNR+ + Sbjct: 19 IEEEVKMQVRGLDFYYGPFHALQHIDLDFFSNQVAALIGPSGCGKSTLLRCLNRMNDLIP 78 Query: 66 --HQQGRIVVDGVELTNDLKQIEAIRREVGMVFQHFNLFPHLTILQNCTLA--------P 115 +G I++D ++ + + ++RR +GMVFQ N FP TI +N Sbjct: 79 SSRVEGEILLDRQDIYHPDLDVVSLRRRIGMVFQKPNPFPK-TIFENVAYGLRVKGVKNR 137 Query: 116 MWVRKMPKRKAEEIAMHYLERVRIPEQAHKYPGQLSGGQQQRVAIARALCMKPKIMLFDE 175 + + + ++ + A+ + R+ E A LSGGQQQR+ IARA+ ++P+++L DE Sbjct: 138 ITISEAVEKSLKGAALWDEVKDRLNESAL----GLSGGQQQRLCIARAMAVEPEVLLMDE 193 Query: 176 PTSALDPEMVKEVLDTMIGLAEDGMTMLCVTHEMGFARTVANRVIFMDKGEIVEQAAPND 235 P SALDP +++ + + L D T++ VTH M A +++R F G ++E + Sbjct: 194 PASALDPIATQKIEELVHELKRD-YTIIIVTHNMQQAARISDRTAFFYMGRLIEFGETKN 252 Query: 236 FFDNPQNDRTKLFLS 250 F P+ +T +++ Sbjct: 253 IFTRPKLKQTSDYIT 267 Lambda K H 0.322 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 271 Length adjustment: 25 Effective length of query: 229 Effective length of database: 246 Effective search space: 56334 Effective search space used: 56334 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory