Align Arginine transport ATP-binding protein ArtM (characterized)
to candidate WP_051184390.1 H567_RS0101930 phosphate ABC transporter ATP-binding protein PstB
Query= SwissProt::P54537 (240 letters) >NCBI__GCF_000422285.1:WP_051184390.1 Length = 289 Score = 154 bits (389), Expect = 2e-42 Identities = 90/236 (38%), Positives = 136/236 (57%), Gaps = 12/236 (5%) Query: 11 FGKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEKPNGGT-----ITIKDTEI 65 +G + + N+S I EV+A+IGPSG GKSTFLRCLN + G I + +T+I Sbjct: 51 YGSKQAIFNVSLDIGRNEVIAMIGPSGCGKSTFLRCLNRMNDTIEGCRVTGDIRLDETDI 110 Query: 66 TKPKTNTLKVRENIGMVFQHFHLFPHKTVLENIMYAP-VNVKKESKQAAQEKAEDLLRKV 124 P + + +R +GMVFQ + FP K++ +N+ Y P ++ E + E E L+K Sbjct: 111 YDPALDVVPLRAQVGMVFQKPNPFP-KSIYDNVAYGPKIHGLAEKRVELDEIVETALQKA 169 Query: 125 GLFEK---RNDYPNR-LSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEMVKEVLQVMK 180 GL+E+ R D P LSGGQ+QR+ IAR +A++P+++L DEP SALDP + ++ Sbjct: 170 GLWEEVKDRLDQPGTGLSGGQQQRLCIARTIAVSPEVILMDEPCSALDPIATARIEDLID 229 Query: 181 ELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRAQDFL 236 EL + T+ IVTH M A ++ R + G +VE G E F PK + +D++ Sbjct: 230 EL-RSHYTIAIVTHSMQQASRISQRTAYFHLGYLVEIGTTPEMFTKPKHRLTEDYI 284 Lambda K H 0.317 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 289 Length adjustment: 25 Effective length of query: 215 Effective length of database: 264 Effective search space: 56760 Effective search space used: 56760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory