Align TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate WP_244155446.1 H567_RS0109105 oligopeptide/dipeptide ABC transporter ATP-binding protein
Query= TCDB::Q9WXN4 (268 letters) >NCBI__GCF_000422285.1:WP_244155446.1 Length = 337 Score = 187 bits (476), Expect = 2e-52 Identities = 107/261 (40%), Positives = 161/261 (61%), Gaps = 12/261 (4%) Query: 3 RLVVKNLTKIFSLGFFSKRRIEAVKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLLPP 62 R V + +F G + ++ A+ ++ ++ EI LVGESGSGKTT ++ILRL P Sbjct: 7 RKVYETKGNLFGRG---RGQVVALDHLDLDIHHGEIFGLVGESGSGKTTAGRLILRLEEP 63 Query: 63 TSGEIYFEGKDIWKDIKDRESLVEFRRKVHAVFQDPFASYNPFYPVERTLWQAIS--LLE 120 G I +G+D +K + +L FR++V +FQDP+ S NP + ++ A+S LL Sbjct: 64 DGGRILLDGQDTCT-LKGK-ALKAFRKRVQMIFQDPYQSLNP----QISILDAVSEPLLI 117 Query: 121 NKPSNKKEALELIKESLFRVGIDP-KDVLGKYPHQISGGQKQRIMIARCWILRPLLIVAD 179 + S + + LE ++ L RVG+ P +D L ++PHQ+SGGQ+QR+ IAR IL P ++VAD Sbjct: 118 HTASKRTDRLEAARDILGRVGLSPPEDFLFRFPHQLSGGQRQRVAIARAMILGPDVVVAD 177 Query: 180 EPTSMIDASSRGGIIKLLEELREEQGTSIIFITHDLGLAYYVSDNIFVMKNGEIVERGHP 239 EPTSM+DAS I +L ELRE +++FITH L A Y+ + I V+ G +VE G Sbjct: 178 EPTSMLDASISAQIFNILLELREAMNVTLLFITHSLAAARYLCNRIAVLYRGHLVELGPA 237 Query: 240 DKVVLEPTHEYTKLLVGSIPK 260 D+++ P H YT+ L+ +IPK Sbjct: 238 DEIIYRPAHPYTQALIDAIPK 258 Lambda K H 0.319 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 337 Length adjustment: 27 Effective length of query: 241 Effective length of database: 310 Effective search space: 74710 Effective search space used: 74710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory