Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate WP_244155490.1 H567_RS0115555 ABC transporter ATP-binding protein
Query= uniprot:A0A1N7U8S3 (276 letters) >NCBI__GCF_000422285.1:WP_244155490.1 Length = 243 Score = 129 bits (323), Expect = 8e-35 Identities = 91/252 (36%), Positives = 129/252 (51%), Gaps = 25/252 (9%) Query: 4 SAQALAAYPVDEPVAQPVTAAIKLQVEGIHKRYGEH----EVLKGVSLNARQGDVISLIG 59 S A AA + EP+ +++ + K YG + LKG+ L G+ ++++G Sbjct: 2 SRNAAAAETMLEPI---------IRLTNVTKTYGSGSAAMQALKGIDLAIHPGEFVAVMG 52 Query: 60 ASGSGKSTMLRCINFLEQPDAGVITLDGISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQ 119 SGSGKST + + L+ P +GV DG+ + R + R L VFQ Sbjct: 53 PSGSGKSTCMNILGCLDTPSSGVFLFDGVDV--------ARLTRDQRALLRRHDLGFVFQ 104 Query: 120 HFNLWSHMTVLENITMAPRRVLDVSAAEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQ 179 FNL S + LEN+ + P V AA + A L VGL S PA LSGGQQQ Sbjct: 105 GFNLLSRTSALENVEL-PLIYRRVPAARRRELALRALAAVGL-SGWESHTPAELSGGQQQ 162 Query: 180 RVAIARALAMEPEIILFDEPTSALDPELVGEVLKVIQTL-AEEGRTMLMVTHEMGFARQV 238 RVAI RA+ EP+++L DEPT LD L EV++++Q+ G T++MVTHE A Sbjct: 163 RVAITRAIVTEPKVLLADEPTGNLDSALSREVMELLQSFNRSRGLTIVMVTHEADMAAYA 222 Query: 239 SSQVLFLHQGRV 250 ++LF GR+ Sbjct: 223 ERRILF-RDGRI 233 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 243 Length adjustment: 24 Effective length of query: 252 Effective length of database: 219 Effective search space: 55188 Effective search space used: 55188 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory