Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_153306068.1 H567_RS0105885 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_000422285.1:WP_153306068.1 Length = 269 Score = 190 bits (483), Expect = 2e-53 Identities = 104/250 (41%), Positives = 157/250 (62%), Gaps = 10/250 (4%) Query: 7 TGQPLLQVNGVET-YYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQART 65 T + +L++ +E Y+ I L GV + V K IV+L+GANGAGKST + + G + Sbjct: 3 TPEAILKIKNIEVKYHEVILVLKGVSIEVPKAGIVALLGANGAGKSTTLKAVSGLLKVED 62 Query: 66 GSVV-----FEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFA 120 G V FEG+ I P +IA++ I Q EGR++F +TV ENL++GA L Sbjct: 63 GEVTDGGIEFEGQMIHHEPAAKIAKMGIVQVIEGRKVFEHLTVEENLKVGAHLRKTGSVK 122 Query: 121 EDVEKIFTLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVK 180 + +E ++ FPRL+++ ++ G +SGGEQQM +GRALM PKL+LLDEPS+GLAP+++ Sbjct: 123 DKLELVYHYFPRLRQKRSETAGFVSGGEQQMTVVGRALMTEPKLVLLDEPSMGLAPMLIH 182 Query: 181 GIFEAIRKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAA 240 IF I +LN+ E +++ LVEQNA AL ++ AYVM G++ M + ++L N +++ Sbjct: 183 EIFNIITQLNKEEKISILLVEQNAKLALNVAPYAYVMETGRIVMDDTAEKLSQNEDIKDF 242 Query: 241 YL----EGGR 246 YL +GGR Sbjct: 243 YLGLTDKGGR 252 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 269 Length adjustment: 24 Effective length of query: 223 Effective length of database: 245 Effective search space: 54635 Effective search space used: 54635 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory