Align GluA aka CGL1950, component of Glutamate porter (characterized)
to candidate WP_084516821.1 H567_RS0103445 phosphate ABC transporter ATP-binding protein PstB
Query= TCDB::P48243 (242 letters) >NCBI__GCF_000422285.1:WP_084516821.1 Length = 271 Score = 142 bits (358), Expect = 7e-39 Identities = 91/245 (37%), Positives = 139/245 (56%), Gaps = 13/245 (5%) Query: 2 IKMTGVQKYFGDFHALTDIDLEIPRGQVVVVLGPSGSGKSTLCRTINRLETI-----EEG 56 +++ G+ Y+G FHAL IDL+ QV ++GPSG GKSTL R +NR+ + EG Sbjct: 25 MQVRGLDFYYGPFHALQHIDLDFFSNQVAALIGPSGCGKSTLLRCLNRMNDLIPSSRVEG 84 Query: 57 TIEIDGKVLPEEGKGLANLRADVGMVFQSFNLFPHLTIKDNVTLAPIKVRKMKK----SE 112 I +D + + + +LR +GMVFQ N FP TI +NV ++V+ +K SE Sbjct: 85 EILLDRQDIYHPDLDVVSLRRRIGMVFQKPNPFPK-TIFENVAYG-LRVKGVKNRITISE 142 Query: 113 A-EKLAMSLLERVGIANQADKYPAQLSGGQQQRVAIARALAMNPKIMLFDEPTSALDPEM 171 A EK + ++ ++ LSGGQQQR+ IARA+A+ P+++L DEP SALDP Sbjct: 143 AVEKSLKGAALWDEVKDRLNESALGLSGGQQQRLCIARAMAVEPEVLLMDEPASALDPIA 202 Query: 172 VNEVLDVMASLAKEGMTMVCVTHEMGFARKAADRVLFMADGLIVEDTEPDSFFTNPKSDR 231 ++ +++ L K T++ VTH M A + +DR F G ++E E + FT PK + Sbjct: 203 TQKIEELVHEL-KRDYTIIIVTHNMQQAARISDRTAFFYMGRLIEFGETKNIFTRPKLKQ 261 Query: 232 AKDFL 236 D++ Sbjct: 262 TSDYI 266 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 271 Length adjustment: 24 Effective length of query: 218 Effective length of database: 247 Effective search space: 53846 Effective search space used: 53846 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory