Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_028321994.1 H567_RS0114755 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_000422285.1:WP_028321994.1 Length = 255 Score = 185 bits (469), Expect = 1e-51 Identities = 108/264 (40%), Positives = 156/264 (59%), Gaps = 12/264 (4%) Query: 14 LLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMITF 73 LL + LS KFGGL A+ SF + G+I +IGPNGAGKTT+FNC++G T G I Sbjct: 3 LLSAKRLSRKFGGLWALYGVSFTVREGEIAGVIGPNGAGKTTLFNCLSGLDYATEGSILH 62 Query: 74 NQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYTIL 133 + + + RL ++ K + RTFQ R+F LTV EN++V H Y ++ Sbjct: 63 -----RGHDITRLTPHQVVKRG-IVRTFQTTRVFKRLTVRENVMVGLHLHSRSNLLYDMI 116 Query: 134 GLIG-VGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGPEL 192 L G V +REA +A+ L LE L D+AD PA +L RR+E+ARA+ T PEL Sbjct: 117 RLPGAVREDRREAEQAMTL----LEAVRLADQADKPADELTLSQARRMELARALATDPEL 172 Query: 193 LCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQKIS 252 L LDEP AGL+ +E L LL+ + G ++++IEHD+ ++ + ++VL YG+ I+ Sbjct: 173 LLLDEPGAGLDEQERDELGTLLRDVH-NRGVTLMVIEHDIGFMVNLCTRIIVLNYGKVIA 231 Query: 253 DGTPDHVKNDPRVIAAYLGVEDEE 276 GTP ++ D +V+ AYLG ED + Sbjct: 232 TGTPLEIQQDKQVLEAYLGEEDAD 255 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 255 Length adjustment: 25 Effective length of query: 267 Effective length of database: 230 Effective search space: 61410 Effective search space used: 61410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory