Align Ketoisovalerate oxidoreductase subunit VorA; VOR; 2-oxoisovalerate oxidoreductase alpha chain; 2-oxoisovalerate-ferredoxin oxidoreductase subunit alpha; EC 1.-.-.- (characterized)
to candidate WP_028319867.1 H567_RS28935 thiamine pyrophosphate-dependent enzyme
Query= SwissProt::P80907 (478 letters) >NCBI__GCF_000422285.1:WP_028319867.1 Length = 246 Score = 242 bits (618), Expect = 9e-69 Identities = 116/242 (47%), Positives = 156/242 (64%) Query: 12 LHEVFERKGGSAPTATHYCAGCGHGILHKLIGEAIDELGIQERSVMISPVGCAVFAYYYF 71 + +VF R H+C GC HGI+H+L E ID +QE S+ ++ VGC+VF Y Y Sbjct: 1 MEQVFSRPQSLIDVPFHFCPGCHHGIIHRLTAECIDRYALQETSIAVASVGCSVFLYDYL 60 Query: 72 DCGNVQVAHGRAPAVGTGISRAEDTPVVLLYQGDGDLASIGLNETIQAANRGEKMAVFFV 131 D ++ HGRA AV TG+ RA V YQGDGDLA+IG E I AANRG+++ V FV Sbjct: 61 DVDVLEAPHGRAAAVATGVKRARPDRFVFTYQGDGDLAAIGTAEIIHAANRGDRITVIFV 120 Query: 132 NNTVYGMTGGQMAPTTLIGEVTVTCPGGRDPRYAGYPLHMCELLDNLQAPVFIERVSLAD 191 NNTV+GMTGGQMAPTT+ G+ T T P GRDP G+P+ M ELL L F+ R ++ Sbjct: 121 NNTVFGMTGGQMAPTTMPGQETTTTPFGRDPAVNGFPIRMAELLGGLTGTTFVARGAVDT 180 Query: 192 PKSIRKAKRAVKRALEIQRDGKGYAFVEVLSPCPTNLRQDAEGAERFLKEEMEREFPVKN 251 PK++ K ++ ++RA E+Q G+G+ FVE+LS CPTN + E A + +KEEM FP+ Sbjct: 181 PKNLVKTRKYMQRAFEVQTTGEGFGFVEILSACPTNWKMSPERANKRVKEEMIPYFPLGI 240 Query: 252 FR 253 F+ Sbjct: 241 FK 242 Lambda K H 0.318 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 478 Length of database: 246 Length adjustment: 29 Effective length of query: 449 Effective length of database: 217 Effective search space: 97433 Effective search space used: 97433 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory