Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate WP_028322100.1 H567_RS0115475 enoyl-CoA hydratase-related protein
Query= BRENDA::Q1D5Y4 (258 letters) >NCBI__GCF_000422285.1:WP_028322100.1 Length = 256 Score = 169 bits (429), Expect = 4e-47 Identities = 99/246 (40%), Positives = 143/246 (58%), Gaps = 2/246 (0%) Query: 12 IEIWTIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGDKAFCAGADLKERAT 71 + + TID NA++ ++ EL + V VR +VITGAG K F AGADL Sbjct: 12 VRVLTID-RPPVNALNEEIVDELRDAVKAAMLDGRVRVLVITGAG-KIFVAGADLDRLLA 69 Query: 72 MAEDEVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAAPAAELGLT 131 D R DG++ R + + IAAING A GGG ELA+ACD+R+A A +GL Sbjct: 70 ADMDAGRKMADGVKGLHREMRQGGKPVIAAINGMAAGGGLELAMACDVRIADQNARMGLP 129 Query: 132 EVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAPEGHLLAVAY 191 EV LG++PG GGTQ L RLVG G+A +++ T I+A +A +GL ++A L +A Sbjct: 130 EVTLGVLPGAGGTQMLPRLVGAGKAMEMMFTGMIIDANDALQLGLVEQVAIVESALDLAL 189 Query: 192 GLAESVVENAPIAVATAKHAIDEGTGLELDDALALELRKYEEILKTEDRLEGLRAFAEKR 251 +A +V+NAP+A++ K A+ + L LD LA E ++ + +T D+ EG+ AF +R Sbjct: 190 KMAARMVKNAPLAISEIKAAVYDTMSLPLDQGLAEETGRFARLCRTADKNEGITAFKSRR 249 Query: 252 APVYKG 257 V+KG Sbjct: 250 TAVFKG 255 Lambda K H 0.319 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 256 Length adjustment: 24 Effective length of query: 234 Effective length of database: 232 Effective search space: 54288 Effective search space used: 54288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory