Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate WP_028322786.1 H567_RS0120240 enoyl-CoA hydratase-related protein
Query= BRENDA::F4JML5 (301 letters) >NCBI__GCF_000422285.1:WP_028322786.1 Length = 260 Score = 181 bits (458), Expect = 2e-50 Identities = 101/250 (40%), Positives = 149/250 (59%), Gaps = 2/250 (0%) Query: 51 SDSGIIEVNLDRPVTKNAINKEMLKSLQNAFESIHQDNSARVVMIRSLVPGVFCAGADLK 110 +D GI+ +N RP NA+N+E+++ +++ I +++ +V++ F AGAD+K Sbjct: 12 NDIGILTIN--RPKAMNALNEEVIQEVESVLRDIKGNSAVKVLIFTGAGEKAFVAGADVK 69 Query: 111 ERRTMSPSEVHTYVNSLRYMFSFIEALSIPTIAAIEGAALGGGLEMALACDLRICGENAV 170 R+ E V M IE L IPTIAA+ G ALGGG E+A++C LR+ ENA Sbjct: 70 NIRSWGLKEGFDAVRIGHQMNYDIETLGIPTIAAVNGLALGGGCELAMSCTLRVVSENAK 129 Query: 171 FGLPETGLAIIPGAGGTQRLSRLVGRSVSKELIFTGRKIDAIEAANKGLVNICVTAGEAH 230 FGLPE GL +IPG GGTQRL+RL+G+ + + TG IDA A + GL N+ V E Sbjct: 130 FGLPELGLGVIPGYGGTQRLTRLIGKGRALWYLLTGDMIDAKTAVDFGLANLVVKPEELI 189 Query: 231 EKAIEMAQQINEKGPLAIKMAKKAIDEGIETNMASGLEVEEMCYQKLLNTQDRLEGLAAF 290 ++ +E+A +I EK PLA+K A+ G ET++ +GL +E + + D+ EG+ AF Sbjct: 190 KRCLEIAGKIAEKAPLAVKSTLFAVKYGSETDLETGLILESALANLTIASDDKNEGIDAF 249 Query: 291 AEKRKPLYTG 300 KRKP + G Sbjct: 250 YGKRKPHFKG 259 Lambda K H 0.318 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 260 Length adjustment: 26 Effective length of query: 275 Effective length of database: 234 Effective search space: 64350 Effective search space used: 64350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory