Align Methylglutaconyl-CoA hydratase, mitochondrial; AU-specific RNA-binding enoyl-CoA hydratase; AU-binding enoyl-CoA hydratase; muAUH; Itaconyl-CoA hydratase; EC 4.2.1.18; EC 4.2.1.56 (characterized)
to candidate WP_315861782.1 H567_RS0110895 enoyl-CoA hydratase-related protein
Query= SwissProt::Q9JLZ3 (314 letters) >NCBI__GCF_000422285.1:WP_315861782.1 Length = 263 Score = 172 bits (436), Expect = 8e-48 Identities = 94/251 (37%), Positives = 147/251 (58%), Gaps = 4/251 (1%) Query: 64 IVVLGINRAYGKNALSKNLLKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAK 123 I V+ NR NA++ +L +S A+D +++++ V+ ++ E F AGAD+ A Sbjct: 15 IAVIKFNRPKALNAINPAVLAEVSAALDEIEANRAVKVLVFTGEGEKSFIAGADIAHMAN 74 Query: 124 MHSSEVGPFVSKIRSVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLV 183 + E F + + ++ I LP+P IA ++G ALGGG E A+ACD A+ AK G Sbjct: 75 LSPLEGRKFSREGQDLLLRIEKLPIPVIACVNGFALGGGTEFAMACDFIYASEKAKFGQP 134 Query: 184 ETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGQEAKAVGLISHVLEQNQEGDAAY 243 E+ L IIPG GGTQRL R +G ++AKEL + V+ +EA+ +GL++ V DA + Sbjct: 135 ESNLGIIPGFGGTQRLARLVGKAMAKELCMAGNVIGAEEARQIGLVNKVF----AADALW 190 Query: 244 RKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTISTKDRLEGLLAF 303 + + A+ +G V+MR K I++G++VDL TG +E +A +++ D EG+ AF Sbjct: 191 EETMKTAKLIASKGKVSMRGIKHCIDRGLDVDLRTGCYLESDAFALCMASPDGSEGMKAF 250 Query: 304 KEKRPPRYKGE 314 EKR P +KGE Sbjct: 251 LEKRKPDFKGE 261 Lambda K H 0.318 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 263 Length adjustment: 26 Effective length of query: 288 Effective length of database: 237 Effective search space: 68256 Effective search space used: 68256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory