Align non-biotin containing subunit of 3-methylcrotonyl-CoA carboxylase; EC 6.4.1.4 (characterized)
to candidate WP_028322455.1 H567_RS0118015 acyl-CoA carboxylase subunit beta
Query= CharProtDB::CH_122289 (587 letters) >NCBI__GCF_000422285.1:WP_028322455.1 Length = 516 Score = 238 bits (608), Expect = 3e-67 Identities = 162/493 (32%), Positives = 246/493 (49%), Gaps = 24/493 (4%) Query: 85 MQEVLNRMNSLHSTISQGGPQKAKDKHVARGKMLPRDRVSALIDPGTSFLELSQLAGHEV 144 +++ + + + GG Q+ D+ A+ K+ R+R+ L+D GT F EL + H Sbjct: 3 VEDKIQELQKRNREAELGGGQRRIDEQHAKSKLTARERIGFLLDEGT-FEELDKFVLHRC 61 Query: 145 YP----GEDVPAGGIITGIGTVEGVTCMIVANDSTVKGGTYYPVTVKKHLRAQAIAQENK 200 + + VP G++TG GT+ G + A D TV GG+ +K + +A ++ Sbjct: 62 HDFGMEKQRVPGDGVVTGFGTINGRLVFVFAQDFTVFGGSLSGAFGEKVCKIMDLALKSG 121 Query: 201 LPCIYLVDSGGANLPHQADVFPDKEHFGRIFFNQARMSSQGIPQISVVMGPCTAGGAYVP 260 P I L DSGGA + +G IF S +PQISV+MGPC G Y P Sbjct: 122 APIIGLNDSGGARIQEGVVSLAS---YGEIFKRNVFCSGV-VPQISVIMGPCAGGAVYSP 177 Query: 261 AMSDETIIVENQGTIFLAGPPLVKAATGEVVSAEDLGGGQLHSTISGVTDYLAVDDAHAI 320 A++D I+V+ +F+ GP ++K T E V++++LGG H+ SGV + A D A+ Sbjct: 178 ALTDFIIMVKRTSNMFITGPEVIKTVTAETVTSDELGGALTHNAKSGVAHFAAESDYDAL 237 Query: 321 VLARRSISNLNYPKAKQPLESNDDIKEPLYDPAELNGIVGTNLRRQIPVHEVIARIVDGS 380 ++ + L + PLE + + +P LN IV TN R + E+I ++D Sbjct: 238 DNVKKLLGFLPQNFREMPLE-KECVDDPKRTDKSLNKIVPTNPRTPYDMKEIIHSVLDNH 296 Query: 381 EFAEFKRDYGTTLVTGFARIHGHRVGIVANN-----GILFSESSLKGAHFIELCAQRNIP 435 EF E +R + L+ GF R++G VGIVAN G L +SLK + F+ C NIP Sbjct: 297 EFFEVQRRFAMNLIVGFGRLNGMVVGIVANQPRVLAGCLDINASLKCSRFVRTCDCFNIP 356 Query: 436 LVFLQNISGFMVGADAEKGGIAKNGAKLVTAVACADVPKFTVVFGSSAGAGNYGMCGRAY 495 LV ++ GF+ G + E GGI K+GAK++ A A VPK TV+ + G M + + Sbjct: 357 LVTFVDVPGFLPGINQEYGGIIKHGAKIIYAYCEATVPKITVITRKAYGGAYDVMSSKHH 416 Query: 496 SPRFLFMWPNAKIGVMGSE----LSSVMEAVGRTADPELKARIDRESEATFSS----ARL 547 F +P A+I VMG E + E G T +K + E +F+S A L Sbjct: 417 GADINFAYPTAEIAVMGPEGAVNIIYKKEINGATNGEHIKKKFVEEYRESFASPFKAAEL 476 Query: 548 -WDDGIIPPAHTR 559 + D II P +TR Sbjct: 477 GYIDHIIFPENTR 489 Lambda K H 0.318 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 691 Number of extensions: 29 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 587 Length of database: 516 Length adjustment: 36 Effective length of query: 551 Effective length of database: 480 Effective search space: 264480 Effective search space used: 264480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory