Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate WP_028322786.1 H567_RS0120240 enoyl-CoA hydratase-related protein
Query= BRENDA::A4YI89 (259 letters) >NCBI__GCF_000422285.1:WP_028322786.1 Length = 260 Score = 213 bits (541), Expect = 4e-60 Identities = 110/260 (42%), Positives = 167/260 (64%), Gaps = 1/260 (0%) Query: 1 MEFETIETKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKG-K 59 M+++ +E K E ++ +T+NRP +NALN ++++E++ + + + ++V+I TG G K Sbjct: 1 MKYKNVEFKTENDIGILTINRPKAMNALNEEVIQEVESVLRDIKGNSAVKVLIFTGAGEK 60 Query: 60 AFCAGADITQFNQLTPAEAWKFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALACD 119 AF AGAD+ E + + G ++ IE L PTIA +NG ALGGG ELA++C Sbjct: 61 AFVAGADVKNIRSWGLKEGFDAVRIGHQMNYDIETLGIPTIAAVNGLALGGGCELAMSCT 120 Query: 120 IRIAAEEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVN 179 +R+ +E A+ GLPE+ LG+ PGYGGTQRLTR+IGKGRAL ++TGD I K A +GL N Sbjct: 121 LRVVSENAKFGLPELGLGVIPGYGGTQRLTRLIGKGRALWYLLTGDMIDAKTAVDFGLAN 180 Query: 180 RVVPLANLEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFSTE 239 VV L + ++A KIA+K+P+++ V G ++ L +GL LES + +++ Sbjct: 181 LVVKPEELIKRCLEIAGKIAEKAPLAVKSTLFAVKYGSETDLETGLILESALANLTIASD 240 Query: 240 DKKEGVSAFLEKREPTFKGK 259 DK EG+ AF KR+P FKG+ Sbjct: 241 DKNEGIDAFYGKRKPHFKGQ 260 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 260 Length adjustment: 24 Effective length of query: 235 Effective length of database: 236 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory