GapMind for catabolism of small carbon sources

 

Protein WP_028988618.1 in Thermithiobacillus tepidarius DSM 3134

Annotation: NCBI__GCF_000423825.1:WP_028988618.1

Length: 274 amino acids

Source: GCF_000423825.1 in NCBI

Candidate for 20 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-proline catabolism proV lo Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) 37% 56% 142.9 toluene tolerance protein Ttg2A 60% 320.9
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 64% 141 toluene tolerance protein Ttg2A 60% 320.9
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 64% 141 toluene tolerance protein Ttg2A 60% 320.9
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 64% 141 toluene tolerance protein Ttg2A 60% 320.9
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 64% 141 toluene tolerance protein Ttg2A 60% 320.9
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 64% 141 toluene tolerance protein Ttg2A 60% 320.9
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 64% 141 toluene tolerance protein Ttg2A 60% 320.9
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 64% 141 toluene tolerance protein Ttg2A 60% 320.9
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 64% 141 toluene tolerance protein Ttg2A 60% 320.9
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 37% 83% 138.3 toluene tolerance protein Ttg2A 60% 320.9
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 37% 83% 138.3 toluene tolerance protein Ttg2A 60% 320.9
putrescine catabolism potA lo Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) 33% 58% 136.7 toluene tolerance protein Ttg2A 60% 320.9
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 31% 78% 114.8 toluene tolerance protein Ttg2A 60% 320.9
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 32% 59% 114.4 toluene tolerance protein Ttg2A 60% 320.9
L-alanine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 98% 110.2 toluene tolerance protein Ttg2A 60% 320.9
L-histidine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 98% 110.2 toluene tolerance protein Ttg2A 60% 320.9
L-leucine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 98% 110.2 toluene tolerance protein Ttg2A 60% 320.9
L-proline catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 98% 110.2 toluene tolerance protein Ttg2A 60% 320.9
L-serine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 98% 110.2 toluene tolerance protein Ttg2A 60% 320.9
L-threonine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 98% 110.2 toluene tolerance protein Ttg2A 60% 320.9

Sequence Analysis Tools

View WP_028988618.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSPAHNNNILEIRNLGFFRADRAILSDLNIRIPRGQIVAILGGSGTGKTTLLQLMGGQLR
PRRGEVLLDGVALASLGQQELYEARKRMGMLFQHSALLTDLSVFENVAFPLRRHTRLSEP
VLRTLVLMKLEAVGLRGAHALMPSQLSGGMARRVALARAVVMDPDLILYDEPFTGLDPIS
LGVVVSLIKRLNQALGASSVVVSHDVAETLSIADYAYILANGRVIGEGTPAALRDSRSPL
VRQFLDGAPDGPVPFHYAAPLNYEQDLLNARPAP

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory