Align Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 2.1.2.- (characterized)
to candidate WP_028989560.1 G579_RS0106670 formate-dependent phosphoribosylglycinamide formyltransferase
Query= SwissProt::P33221 (392 letters) >NCBI__GCF_000423825.1:WP_028989560.1 Length = 393 Score = 432 bits (1110), Expect = e-125 Identities = 235/390 (60%), Positives = 278/390 (71%), Gaps = 3/390 (0%) Query: 4 LGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLD 63 +GT L ATR++LLGSGELGKE IE QRLGVEVIAVDRYA+APAM VAHRS V++M D Sbjct: 3 IGTPLSANATRILLLGSGELGKEFVIEAQRLGVEVIAVDRYANAPAMQVAHRSQVLDMTD 62 Query: 64 GDALRRVVELEKPHYIVPEIEAIATDMLIQLEEEGL-NVVPCARATKLTMNREGIRRLAA 122 G A++ +V E+P ++VPEIEAI TD+L ++E EGL V+P ARA +LTMNREGIRRLAA Sbjct: 63 GAAVKALVRRERPDFVVPEIEAINTDILAEIEAEGLATVIPTARAARLTMNREGIRRLAA 122 Query: 123 EELQLPTSTYRFADSESLFREAVADIGYPCIVKPVMSSSGKGQTFIRSAEQLAQAWKYAQ 182 EEL LPTS +RFA+SE+ +A +GYPC+VKP+MSSSGKGQ+ IR E A AW YA Sbjct: 123 EELGLPTSRFRFAESEAELLDAAEALGYPCVVKPIMSSSGKGQSTIRRREDAAAAWAYAA 182 Query: 183 QGGRAGAGRVIVEGVVKFDFEITLLTVSAVDGVHFCAPVGHRQEDGDYRESWQPQQMSPL 242 G R RVIVE V FDFEITLLT G FC P+GHRQE GDY ESWQPQ MS Sbjct: 183 SGARVAGQRVIVESFVDFDFEITLLTARTAFGTVFCEPIGHRQEHGDYVESWQPQYMSDA 242 Query: 243 ALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGMVTLISQDLSEFAL 302 AL AQEIA+ + LGG G+FGVELFV GD VIFSEVSPRPHDTG+VTL SQ++SEF + Sbjct: 243 ALRTAQEIAQIITDNLGGCGIFGVELFVKGDTVIFSEVSPRPHDTGLVTLASQNMSEFEI 302 Query: 303 HVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVTFDNVQNAVGA-DLQIRLFGKPEIDGS 361 H+RA LGLPV + GPAASAVI + + A+ D ++RLFGKP Sbjct: 303 HLRAILGLPVMP-QVLGPAASAVIYGGGEGWAPCYTGLAEALSVPDSRVRLFGKPYAGPR 361 Query: 362 RRLGVALATAESVVDAIERAKHAAGQVKVQ 391 RR+GVALA V +A ERA A V V+ Sbjct: 362 RRMGVALARGRDVEEARERAVKTASLVGVR 391 Lambda K H 0.320 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 393 Length adjustment: 31 Effective length of query: 361 Effective length of database: 362 Effective search space: 130682 Effective search space used: 130682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory