Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate WP_028988925.1 G579_RS0102485 ABC transporter ATP-binding protein
Query= TCDB::Q97VF5 (362 letters) >NCBI__GCF_000423825.1:WP_028988925.1 Length = 324 Score = 171 bits (432), Expect = 3e-47 Identities = 99/294 (33%), Positives = 164/294 (55%), Gaps = 2/294 (0%) Query: 63 IKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPPGKIISGKVIFNGMDIFSMT 122 ++ V+ V + E++ ++GESGSGK+ +I+ + P + G + F G D+ + Sbjct: 20 LRPVDGVDLQIGASELVCLVGESGSGKSLTALSIMGLLGPGLRTRGGSIAFQGEDLLRLP 79 Query: 123 IDEFRKLLWKDISYVPQASQNALNPVLPISEIFYHEAISHGEADKKRVIERASELLKLVG 182 + R+L I+ V Q +LNPV I + H + + +A+ELL VG Sbjct: 80 RERLRQLRGNRIAMVFQEPMTSLNPVFAIGRQVAEPLMVHLGLSRSAALAKAAELLDQVG 139 Query: 183 LDPARV-LKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEPTSALDMLNQELLLKLIKNI 241 + AR L+ YP +LSGG +QRVMIA++L P L++ DEPT+ALD+ Q +L LIK + Sbjct: 140 IRDARARLRAYPDELSGGQRQRVMIAMALACAPDLLIADEPTTALDVTIQAQILDLIKEL 199 Query: 242 NQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTEEIIKSPLNPYTSLLVSSIPS 301 ++ G+ ++++THD +A+IA+R+ VMY G V+E+G +++SP + YT+ L++ +P Sbjct: 200 QRQRGMAVLFITHDFDVVARIADRVAVMYAGQVVEQGPARVVLQSPRHSYTAGLLACLPD 259 Query: 302 LKGEVKVINVPLDEP-LVSKEKGCPFLARCSKAFGRCKEELPEIRLVYDRKVRC 354 L G + + P L + GC F RC A C+E + + R+ RC Sbjct: 260 LAGRRHLRPIAGQVPALDAIPPGCRFAPRCPLAQPVCREAPVPLLELDGRQSRC 313 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 324 Length adjustment: 29 Effective length of query: 333 Effective length of database: 295 Effective search space: 98235 Effective search space used: 98235 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory