Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate WP_028988925.1 G579_RS0102485 ABC transporter ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >NCBI__GCF_000423825.1:WP_028988925.1 Length = 324 Score = 155 bits (393), Expect = 1e-42 Identities = 99/240 (41%), Positives = 137/240 (57%), Gaps = 13/240 (5%) Query: 12 RVAGREIPALQPTR---LNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPS----GGRILV 64 RVA + PAL+P L I A ++ L+G SG+GKS I L P GG I Sbjct: 11 RVALAKDPALRPVDGVDLQIGASELVCLVGESGSGKSLTALSIMGLLGPGLRTRGGSIAF 70 Query: 65 EGEDVTALDAEGLRRFR-QRVGMIFQH--FNLLSSKTVADNIAMPLRLAGGFSRAEVDAR 121 +GED+ L E LR+ R R+ M+FQ +L + +A PL + G SR+ A+ Sbjct: 71 QGEDLLRLPRERLRQLRGNRIAMVFQEPMTSLNPVFAIGRQVAEPLMVHLGLSRSAALAK 130 Query: 122 VSELLARVGLSD---HARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTA 178 +ELL +VG+ D R YP +LSGGQ+QRV IA ALAC P +L+ DE T+ALD A Sbjct: 131 AAELLDQVGIRDARARLRAYPDELSGGQRQRVMIAMALACAPDLLIADEPTTALDVTIQA 190 Query: 179 SVLQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTT 238 +L L+ E+ R+ + ++ ITH+ DV+ R+ D+VAVM G +VEQG V P+H T Sbjct: 191 QILDLIKELQRQRGMAVLFITHDFDVVARIADRVAVMYAGQVVEQGPARVVLQSPRHSYT 250 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 324 Length adjustment: 28 Effective length of query: 307 Effective length of database: 296 Effective search space: 90872 Effective search space used: 90872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory