Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_028988925.1 G579_RS0102485 ABC transporter ATP-binding protein
Query= TCDB::Q9X271 (324 letters) >NCBI__GCF_000423825.1:WP_028988925.1 Length = 324 Score = 277 bits (708), Expect = 3e-79 Identities = 143/308 (46%), Positives = 201/308 (65%), Gaps = 2/308 (0%) Query: 1 MMELLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINR 60 M ELL + +L+V + + ++ VDG+ ++ E + +VGESGSGKS++ LS++ L+ Sbjct: 1 MPELLAIRDLRVALAK-DPALRPVDGVDLQIGASELVCLVGESGSGKSLTALSIMGLLGP 59 Query: 61 NGRIVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWH 120 R G F G+DLL+L +E LR +RG I+++FQ PMTSLNP+ +G QV EP++ H Sbjct: 60 GLRTRGGSIAFQGEDLLRLPRERLRQLRGNRIAMVFQEPMTSLNPVFAIGRQVAEPLMVH 119 Query: 121 RLMKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADE 180 + A +A ELL++VGI ++ R YP + SGG RQRVMIAMALAC P LLIADE Sbjct: 120 LGLSRSAALAKAAELLDQVGIRDARARLRAYPDELSGGQRQRVMIAMALACAPDLLIADE 179 Query: 181 PTTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVE 240 PTTALDVTIQAQI++L++EL+ + GM+V+FITHD V DR+ MYAG++VE+ P Sbjct: 180 PTTALDVTIQAQILDLIKELQRQRGMAVLFITHDFDVVARIADRVAVMYAGQVVEQGPAR 239 Query: 241 EILKTPLHPYTKGLLNSTLEIGSRGKKLVPIPGNPPNPTKHPSGCKFHPRCSFAMEICQR 300 +L++P H YT GLL ++ R + L PI G P P GC+F PRC A +C+ Sbjct: 240 VVLQSPRHSYTAGLLACLPDLAGR-RHLRPIAGQVPALDAIPPGCRFAPRCPLAQPVCRE 298 Query: 301 EEPPLVNI 308 PL+ + Sbjct: 299 APVPLLEL 306 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 324 Length adjustment: 28 Effective length of query: 296 Effective length of database: 296 Effective search space: 87616 Effective search space used: 87616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory