Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate WP_028990434.1 G579_RS0112390 glucose 1-dehydrogenase
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_000423825.1:WP_028990434.1 Length = 253 Score = 98.2 bits (243), Expect = 1e-25 Identities = 84/259 (32%), Positives = 121/259 (46%), Gaps = 25/259 (9%) Query: 8 VKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGN----NCVFAPA 63 + G VA++TGG G+G A A + +G V+ + G+ A +L CV A Sbjct: 3 LNGKVAIVTGGGQGIGKAIARHCLERGLKVVIAEADAEAGQETAAELAALGDIRCV--AA 60 Query: 64 DVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLM 123 DV E+DVQ + A +GR+D VN AGI + L +L +++RVLDVNL Sbjct: 61 DVAREEDVQRTVREAVDGYGRLDYLVNNAGIMIRKPVTEL------SLAEWRRVLDVNLS 114 Query: 124 GTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIA 183 F + A P +RG I+N AS + AYSASKGGI+ +T +A Sbjct: 115 SVFLGAKHAA-------PFLRERRGAIVNIASTRGLMSEPATEAYSASKGGIIALTHALA 167 Query: 184 RDLAPIGIRVMTIAPGLF--GTPLLTSLPEKVCNFLASQVPFPS-RLGDPAEYAHLVQAI 240 L P +RV ++PG G SL V P+ R+G P + A LV + Sbjct: 168 VSLGP-AVRVNCVSPGWIEAGDWKKRSLRHPVQLREEDHRQHPAGRVGRPEDVASLVLYL 226 Query: 241 I--ENPFLNGEVIRLDGAI 257 + E F+ G +DG + Sbjct: 227 LSDEAGFVTGADFVVDGGM 245 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 253 Length adjustment: 24 Effective length of query: 237 Effective length of database: 229 Effective search space: 54273 Effective search space used: 54273 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory