Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_028990434.1 G579_RS0112390 glucose 1-dehydrogenase
Query= BRENDA::Q1J2J0 (255 letters) >NCBI__GCF_000423825.1:WP_028990434.1 Length = 253 Score = 140 bits (352), Expect = 3e-38 Identities = 100/248 (40%), Positives = 132/248 (53%), Gaps = 14/248 (5%) Query: 16 LDGRHALVTGGAQGIGFEIARGLAQAGARVTIADLNPDVGEGAARELDGTFE-RLNVTDA 74 L+G+ A+VTGG QGIG IAR + G +V IA+ + + G+ A EL + R D Sbjct: 3 LNGKVAIVTGGGQGIGKAIARHCLERGLKVVIAEADAEAGQETAAELAALGDIRCVAADV 62 Query: 75 DAVADLARRLPD-------VDVLVNNAGIVRNAPAEDTPDDDWRAVLSVNLDGVFWCCRE 127 D+ R + + +D LVNNAGI+ P + +WR VL VNL VF + Sbjct: 63 AREEDVQRTVREAVDGYGRLDYLVNNAGIMIRKPVTELSLAEWRRVLDVNLSSVFLGAKH 122 Query: 128 FGRTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRGVRVNA 187 L RGAIV+ AS GL+S AY+ASK +I LT +LA VRVN Sbjct: 123 -AAPFLRERRGAIVNIASTRGLMSE--PATEAYSASKGGIIALTHALAVSLGP-AVRVNC 178 Query: 188 VAPGYT-ATPLTRRGLETP-EWRETWLKETPLGRLAEPREIAPAVLYLASDAASFVTGHT 245 V+PG+ A +R L P + RE ++ P GR+ P ++A VLYL SD A FVTG Sbjct: 179 VSPGWIEAGDWKKRSLRHPVQLREEDHRQHPAGRVGRPEDVASLVLYLLSDEAGFVTGAD 238 Query: 246 LVVDGGYT 253 VVDGG T Sbjct: 239 FVVDGGMT 246 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 253 Length adjustment: 24 Effective length of query: 231 Effective length of database: 229 Effective search space: 52899 Effective search space used: 52899 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory