Align 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase; 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; HHED aldolase; 4-hydroxy-2-ketoheptane-1,7-dioate aldolase; HKHD aldolase; EC 4.1.2.52 (characterized)
to candidate WP_028988852.1 G579_RS0102000 aldolase/citrate lyase family protein
Query= SwissProt::Q47098 (262 letters) >NCBI__GCF_000423825.1:WP_028988852.1 Length = 261 Score = 124 bits (311), Expect = 2e-33 Identities = 75/204 (36%), Positives = 110/204 (53%) Query: 3 NSFKAALKAGRPQIGLWLGLSSSYSAELLAGAGFDWLLIDGEHAPNNVQTVLTQLQAIAP 62 N KAAL G+ GL + S E+L AG+D+++ID EH N +T+ ++A Sbjct: 5 NRLKAALGEGKTVFGLLNSVPSPLLVEMLGYAGYDFVIIDMEHVCINPETLENMVRAAEC 64 Query: 63 YPSQPVVRPSWNDPVQIKQLLDVGTQTLLVPMVQNADEAREAVRATRYPPAGIRGVGSAL 122 P+VR P I ++LD G Q ++VP V++ EA +AV+A+RY P G RG+ Sbjct: 65 AGITPLVRVPGVMPEVILRVLDSGAQGVVVPHVRSRAEAEQAVQASRYHPCGARGISGGR 124 Query: 123 ARASRWNRIPDYLQKANDQMCVLVQIETREAMKNLPQILDVEGVDGVFIGPADLSADMGY 182 +P Y +AN ++ V++ IE RE ++ + +IL V GV+ V G DLS G Sbjct: 125 TTGFGTIDLPTYFARANAELMVVLMIEDREGVEAIDEILSVPGVNLVLEGAIDLSQSYGV 184 Query: 183 AGNPQHPEVQAAIEQAIVQIRESG 206 QHP VQAAI++ R SG Sbjct: 185 PAQVQHPRVQAAIQRVADGCRRSG 208 Lambda K H 0.317 0.133 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 261 Length adjustment: 25 Effective length of query: 237 Effective length of database: 236 Effective search space: 55932 Effective search space used: 55932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory