Align D-xylulose reductase (EC 1.1.1.9) (characterized)
to candidate WP_028990434.1 G579_RS0112390 glucose 1-dehydrogenase
Query= BRENDA::Q8GR61 (262 letters) >NCBI__GCF_000423825.1:WP_028990434.1 Length = 253 Score = 124 bits (311), Expect = 2e-33 Identities = 84/257 (32%), Positives = 126/257 (49%), Gaps = 16/257 (6%) Query: 6 NGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYVCDV 65 NGKV +VTG G IG A A E G + + + + EA ++ A + G + R DV Sbjct: 4 NGKVAIVTGGGQGIGKAIARHCLERGLKVVIAEADAEAGQETAAELAALG-DIRCVAADV 62 Query: 66 TSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAFAPVQDYPSDDFARVLTINVTGAFHVLK 125 EE V TV V +G++D+L NNAG PV + ++ RVL +N++ F K Sbjct: 63 AREEDVQRTVREAVDGYGRLDYLVNNAGIM-IRKPVTELSLAEWRRVLDVNLSSVFLGAK 121 Query: 126 AVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAI 185 + + + G IVN AS G+ P AY SKG IIALT A+ L P +RVN + Sbjct: 122 HAA-PFLRERRGAIVNIASTRGLMSEPATEAYSASKGGIIALTHALAVSLGP-AVRVNCV 179 Query: 186 SPGYMGPGFMWERQVELQAKVGSQYFSTDPKVVAQQMIGSVPMRRYGDINEIPGVVAFLL 245 SPG++ G +R + P + ++ P R G ++ +V +LL Sbjct: 180 SPGWIEAGDWKKRSLR------------HPVQLREEDHRQHPAGRVGRPEDVASLVLYLL 227 Query: 246 GDDSSFMTGVNLPIAGG 262 D++ F+TG + + GG Sbjct: 228 SDEAGFVTGADFVVDGG 244 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 8 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 253 Length adjustment: 24 Effective length of query: 238 Effective length of database: 229 Effective search space: 54502 Effective search space used: 54502 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory