Protein WP_027723036.1 in Maridesulfovibrio zosterae DSM 11974
Annotation: NCBI__GCF_000425265.1:WP_027723036.1
Length: 281 amino acids
Source: GCF_000425265.1 in NCBI
Candidate for 26 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
D-cellobiose catabolism | gtsC | hi | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) | 61% | 99% | 347.8 | ABC transporter for D-Cellobiose and D-Salicin, permease component 1 | 40% | 223.8 |
D-glucose catabolism | gtsC | hi | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) | 61% | 99% | 347.8 | ABC transporter for D-Cellobiose and D-Salicin, permease component 1 | 40% | 223.8 |
lactose catabolism | gtsC | hi | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) | 61% | 99% | 347.8 | ABC transporter for D-Cellobiose and D-Salicin, permease component 1 | 40% | 223.8 |
D-maltose catabolism | gtsC | hi | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) | 61% | 99% | 347.8 | ABC transporter for D-Cellobiose and D-Salicin, permease component 1 | 40% | 223.8 |
D-mannose catabolism | TT_C0326 | hi | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) | 61% | 99% | 347.8 | GtsC (GLcG), component of Glucose porter, GtsABCD | 42% | 232.3 |
sucrose catabolism | gtsC | hi | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) | 61% | 99% | 347.8 | ABC transporter for D-Cellobiose and D-Salicin, permease component 1 | 40% | 223.8 |
trehalose catabolism | gtsC | hi | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) | 61% | 99% | 347.8 | ABC transporter for D-Cellobiose and D-Salicin, permease component 1 | 40% | 223.8 |
D-galactose catabolism | PfGW456L13_1896 | med | ABC transporter for D-Galactose and D-Glucose, permease component 2 (characterized) | 43% | 99% | 231.9 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
D-xylose catabolism | gtsC | med | ABC transporter for D-Glucose-6-Phosphate, permease component 1 (characterized) | 41% | 99% | 231.1 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
D-cellobiose catabolism | SMc04257 | med | ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized) | 40% | 92% | 223.8 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
N-acetyl-D-glucosamine catabolism | ngcG | lo | NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized) | 32% | 89% | 155.2 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
D-glucosamine (chitosamine) catabolism | ngcG | lo | NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized) | 32% | 89% | 155.2 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
L-arabinose catabolism | xacI | lo | Xylose/arabinose import permease protein XacI (characterized, see rationale) | 30% | 97% | 150.6 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
D-cellobiose catabolism | glcU | lo | GlcU, component of Glucose, mannose, galactose porter (characterized) | 30% | 94% | 147.9 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
D-galactose catabolism | glcU | lo | GlcU, component of Glucose, mannose, galactose porter (characterized) | 30% | 94% | 147.9 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
D-glucose catabolism | glcU | lo | GlcU, component of Glucose, mannose, galactose porter (characterized) | 30% | 94% | 147.9 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
lactose catabolism | glcU | lo | GlcU, component of Glucose, mannose, galactose porter (characterized) | 30% | 94% | 147.9 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
D-maltose catabolism | glcU | lo | GlcU, component of Glucose, mannose, galactose porter (characterized) | 30% | 94% | 147.9 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
D-mannose catabolism | glcU | lo | GlcU, component of Glucose, mannose, galactose porter (characterized) | 30% | 94% | 147.9 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
sucrose catabolism | glcU | lo | GlcU, component of Glucose, mannose, galactose porter (characterized) | 30% | 94% | 147.9 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
trehalose catabolism | glcU | lo | GlcU, component of Glucose, mannose, galactose porter (characterized) | 30% | 94% | 147.9 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
L-arabinose catabolism | araU | lo | AraU, component of Arabinose, fructose, xylose porter (characterized) | 31% | 98% | 141.4 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
D-fructose catabolism | araU | lo | AraU, component of Arabinose, fructose, xylose porter (characterized) | 31% | 98% | 141.4 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
sucrose catabolism | araU | lo | AraU, component of Arabinose, fructose, xylose porter (characterized) | 31% | 98% | 141.4 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
D-xylose catabolism | araU | lo | AraU, component of Arabinose, fructose, xylose porter (characterized) | 31% | 98% | 141.4 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
trehalose catabolism | thuG | lo | ABC-type transporter, integral membrane subunit, component of Trehalose porter. Also binds sucrose (Boucher and Noll, 2011). Induced by glucose and trehalose. Directly regulated by trehalose-responsive regulator TreR (characterized) | 30% | 98% | 138.7 | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) | 61% | 347.8 |
Sequence Analysis Tools
View WP_027723036.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MNTTNSTKAGIITPRSVLLYGLLFLMALFFLMPAYMAIITALKPPAEINLSTAWELPAKF
HWSSFPEALRLLKPNIVSSVILTVCATVLSTILGSLNGYVFSKWKFKGSELIFTLFLFGM
FIPYQVILIPLFQTLRAMNLYGGLPGLILAHVVYGLPITSLIFRNFYAQIPTALVESARL
DGAGFFSIYTRIVFPLSIPGFVVTSLWQVTQIWNEFLWGICLTRHADNPITVGLAQLAGG
QAVSWNLPMAGSIMAAAPVLAIYIFLGRYFIRGLLAGSVKE
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory