Protein WP_027723182.1 in Maridesulfovibrio zosterae DSM 11974
Annotation: NCBI__GCF_000425265.1:WP_027723182.1
Length: 396 amino acids
Source: GCF_000425265.1 in NCBI
Candidate for 15 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-proline catabolism | opuBA | med | BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) | 52% | 95% | 402.5 | ABC-type quaternary amine transporter (EC 7.6.2.9) | 58% | 443.0 |
| L-proline catabolism | proV | med | Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) | 48% | 99% | 376.3 | ABC-type quaternary amine transporter (EC 7.6.2.9) | 58% | 443.0 |
| L-histidine catabolism | hutV | med | ABC transporter for L-Histidine, ATPase component (characterized) | 56% | 96% | 303.5 | ABC-type quaternary amine transporter (EC 7.6.2.9) | 58% | 443.0 |
| L-proline catabolism | hutV | med | HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) | 55% | 96% | 298.1 | ABC-type quaternary amine transporter (EC 7.6.2.9) | 58% | 443.0 |
| L-tryptophan catabolism | ecfA1 | med | Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) | 40% | 74% | 143.3 | ABC-type quaternary amine transporter (EC 7.6.2.9) | 58% | 443.0 |
| D-maltose catabolism | malK1 | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 42% | 59% | 178.3 | ABC-type quaternary amine transporter (EC 7.6.2.9) | 58% | 443.0 |
| trehalose catabolism | thuK | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 42% | 59% | 178.3 | ABC-type quaternary amine transporter (EC 7.6.2.9) | 58% | 443.0 |
| putrescine catabolism | potA | lo | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) | 33% | 82% | 168.3 | ABC-type quaternary amine transporter (EC 7.6.2.9) | 58% | 443.0 |
| D-mannitol catabolism | mtlK | lo | SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) | 35% | 68% | 157.1 | ABC-type quaternary amine transporter (EC 7.6.2.9) | 58% | 443.0 |
| D-cellobiose catabolism | msiK | lo | MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) | 36% | 58% | 156 | ABC-type quaternary amine transporter (EC 7.6.2.9) | 58% | 443.0 |
| L-histidine catabolism | Ac3H11_2560 | lo | ABC transporter for L-Histidine, ATPase component (characterized) | 37% | 86% | 150.2 | ABC-type quaternary amine transporter (EC 7.6.2.9) | 58% | 443.0 |
| D-maltose catabolism | malK_Aa | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 31% | 61% | 150.2 | ABC-type quaternary amine transporter (EC 7.6.2.9) | 58% | 443.0 |
| D-maltose catabolism | malK_Sm | lo | MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 33% | 65% | 149.8 | ABC-type quaternary amine transporter (EC 7.6.2.9) | 58% | 443.0 |
| trehalose catabolism | malK | lo | MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 33% | 65% | 149.8 | ABC-type quaternary amine transporter (EC 7.6.2.9) | 58% | 443.0 |
| D-glucosamine (chitosamine) catabolism | SM_b21216 | lo | ABC transporter for D-Glucosamine, ATPase component (characterized) | 34% | 66% | 149.1 | ABC-type quaternary amine transporter (EC 7.6.2.9) | 58% | 443.0 |
Sequence Analysis Tools
View WP_027723182.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MEKIRVENLYKIFGSTPNKIIPMLEKGASKDEIKEKHKHGVGVNNASFSVDEGEIVVVMG
LSGSGKSTLVRCINRLIEPTGGKIFIDGTDITKLSQNELRKVRLEKLGMVFQNFALFPHR
TVLKNAEYGLEINGVDPETRKQKATEALELVGLAGWENSYPPQLSGGMQQRVGLARALAL
DPDILLMDEAFSALDPLIRRDMQDELINLQERMHKTIVFISHDLDEALKIGDKIVLMKDG
EIVQTGTPEEILTSPANDYVRRFVEDVDITKVLTAESVMKKTEAVAYIKTDGPRASLRKM
RKNNISSLFVLNEERRLMGVIGVQDCARLVEQGSSDLRSIICTECKTTHLDTPAQDLFIL
LQDLAYPLAVVDTDNRLKGVIIRGTLIGALAERGGN
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory