Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate WP_027721926.1 H589_RS0110275 amino acid ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc02869 (352 letters) >NCBI__GCF_000425265.1:WP_027721926.1 Length = 243 Score = 168 bits (426), Expect = 1e-46 Identities = 94/237 (39%), Positives = 144/237 (60%), Gaps = 6/237 (2%) Query: 20 LQLKTIRKAFGSHEVLKGIDLDVKDGEFVIFVGPSGCGKSTLLRTIAGLEDATSGSVQID 79 +Q+K + K+FG +V+KGIDL VK GE V +GPSG GKST+LR I LE+ TSG++ +D Sbjct: 2 IQIKNLYKSFGQLDVIKGIDLHVKSGEVVCIIGPSGSGKSTVLRCINKLEEPTSGTIIVD 61 Query: 80 GVEV----GHVAPAKRGIAMVFQSYALYPHLTVKDNMGLG-LKQAGVPKAEIEEKVAKAA 134 G ++ ++ + MVFQ + L+PH+T+ +N+ LG +K V K++ E K Sbjct: 62 GHDIMQKSTNINEVRAEAGMVFQQFNLFPHMTILENVTLGPVKVRNVSKSDANELGLKLL 121 Query: 135 GMLSLEPYLARRPAELSGGQRQRVAIGRAIVREPKLFLFDEPLSNLDAALRVNTRLEIAR 194 + L+ P +LSGGQ+QRVAI R++ +PK+ LFDEP S LD L V LE+ + Sbjct: 122 EKVGLKDKARNYPDQLSGGQKQRVAIARSLALQPKVILFDEPTSALDPEL-VGEVLEVMQ 180 Query: 195 LHRSLKATMIYVTHDQVEAMTLADKIVVLNAGRIEQVGSPMELYNRPANLFVAGFIG 251 TM+ VTH+ A +AD+++ ++ G I++ G P E++ P N + F+G Sbjct: 181 QLAKEGMTMVVVTHEMGFAKEVADRLIFIDEGIIQEEGVPAEVFANPKNPRLKDFLG 237 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 243 Length adjustment: 26 Effective length of query: 326 Effective length of database: 217 Effective search space: 70742 Effective search space used: 70742 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory