Align Electron transfer protein (characterized, see rationale)
to candidate WP_027723004.1 H589_RS0116275 SLBB domain-containing protein
Query= uniprot:E3PU00 (428 letters) >NCBI__GCF_000425265.1:WP_027723004.1 Length = 442 Score = 147 bits (372), Expect = 5e-40 Identities = 89/234 (38%), Positives = 133/234 (56%), Gaps = 10/234 (4%) Query: 79 IEAIQEAGIVGSGGAGFPTHVKLNVNLEGGYVIANGAECEPVLGHNIKLMEEDPQLIIRG 138 +E I+E G+VG+GGAG PTHVK ++ V+ NGA CEP+L + LME + ++IRG Sbjct: 6 VEKIRETGVVGAGGAGLPTHVKAEATVDT--VLVNGASCEPLLMSDPYLMEAEIDVVIRG 63 Query: 139 LKYVKEITNASKAYIAMKAKHRKALRILKTACELEPD--IEVKILPDMYPAGDERAIVRD 196 L+ + + T A K I +K KH KAL +K A + +E L D YPAGDE +V + Sbjct: 64 LEAILDCTGAKKGIICLKGKHHKALVSVKEAVAKDTSGRLEYFELKDFYPAGDEHVLVHE 123 Query: 197 ILGVLLEPGQLPKAANAVIQNVETLKHIVNAIELRKPYITKDITVAGRVMDATDGKVFMD 256 +LG + +P AV+ NVE+L ++ A+E P + +TVAG + + + Sbjct: 124 VLGRTVPERGIPLQVGAVVSNVESLLNVAYAME-DIPVTHRYLTVAGEIKT----PMVVK 178 Query: 257 VPVGESVKKYIDLCGGYMNPHGEIVMGGPFTGRHVEE-DAPITKTTGGILVAMP 309 VPVG V ++ GG + ++V GGP GR + + + +TKTT G+LV P Sbjct: 179 VPVGTLVSDVLNFAGGPLISDYKVVDGGPMMGRVLPDINQSVTKTTSGLLVLPP 232 Score = 48.1 bits (113), Expect = 5e-10 Identities = 25/57 (43%), Positives = 38/57 (66%), Gaps = 2/57 (3%) Query: 5 LLLKQHVGAPCQSIVEAGQKVQKGELIAK-PNG-LGANLHSSVYGVVKAVNETAIII 59 + L+QH+GAP V AG V KG+LI + P G +GA +H+S+ GVV++V + + I Sbjct: 383 IALRQHIGAPATCCVSAGDMVAKGDLIGEIPEGAMGARVHASIDGVVESVADGKVTI 439 Lambda K H 0.318 0.137 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 542 Number of extensions: 27 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 428 Length of database: 442 Length adjustment: 32 Effective length of query: 396 Effective length of database: 410 Effective search space: 162360 Effective search space used: 162360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory