Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate WP_027723039.1 H589_RS0116465 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SMc04256 (361 letters) >NCBI__GCF_000425265.1:WP_027723039.1 Length = 365 Score = 315 bits (807), Expect = 1e-90 Identities = 167/366 (45%), Positives = 244/366 (66%), Gaps = 7/366 (1%) Query: 1 MTSVSVRDLSLNFGAVTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQI 60 M +V ++++ +G+V V+ ++L ++ EF+VL+G SGCGKSTLL +AGL ++S G+I Sbjct: 1 MANVELKNVIKRYGSVEVIHGVDLSVNENEFIVLVGPSGCGKSTLLRMVAGLENLSGGEI 60 Query: 61 FIKDRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEI 120 I DR V PKDR + MVFQ+YALYP MTV +N+ F LK+ K EIE RV A+ I Sbjct: 61 HIGDRVVNNVSPKDRNVAMVFQNYALYPHMTVGENMGFSLKMHKRSKEEIESRVNEAARI 120 Query: 121 LQIQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLH 180 L+++P L RKP+ELSGGQRQRVA+GRA+VR+ DVFLFDEPLSNLDA+LR+++R+E++++H Sbjct: 121 LELEPYLHRKPAELSGGQRQRVAMGRAMVRNPDVFLFDEPLSNLDAQLRTQMRMELRKMH 180 Query: 181 QSLKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPSMN 240 L+ T IYVTHDQIEA+TLADRI ++K G IQQ+ P+ ++ P N+FVA FIG+P MN Sbjct: 181 LRLRTTTIYVTHDQIEAMTLADRIVILKDGYIQQVGSPVEVFEKPNNVFVAKFIGNPPMN 240 Query: 241 FFRGEVEPKDGRSFVRAGGIAFDVTAYPAHTRLQPGQKVVLGLRPEHVKVDEARDGEP-- 298 G + DG+ +V G F + A + + G V+ GLRP+ +K+ + + P Sbjct: 241 ILEGVCKVIDGKRYVVIGKTRFPIQDGVAKS-IVDGSPVLAGLRPDSIKMGQNIERLPKD 299 Query: 299 --THQAVVDIEEPMGADNLLWLTFAGQS-MSVRIAGQRRYPPGSTVRLSFDMGVASIFDA 355 H VV + E +GA +LL + G++ + + G+ PG TV + F+ +FD Sbjct: 300 WWCHGEVV-VSEILGAHSLLEIVIDGENELIAEVEGRIIAHPGETVPIGFEFDRMVLFDP 358 Query: 356 ESENRL 361 +++ L Sbjct: 359 QTQEAL 364 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 365 Length adjustment: 29 Effective length of query: 332 Effective length of database: 336 Effective search space: 111552 Effective search space used: 111552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory