Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_027722696.1 H589_RS0114460 phosphoglycerate kinase
Query= BRENDA::P36204 (654 letters) >NCBI__GCF_000425265.1:WP_027722696.1 Length = 397 Score = 351 bits (900), Expect = e-101 Identities = 192/396 (48%), Positives = 260/396 (65%), Gaps = 11/396 (2%) Query: 6 IRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRPKG 65 I +D+ GK+++MRVDFNVP+ + DD RI+AA+PTI+YALEQGA +I+++HLG+PKG Sbjct: 4 IDQLDIAGKKLLMRVDFNVPLDGETITDDNRIKAAVPTIRYALEQGAAIIVMAHLGKPKG 63 Query: 66 EPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE-T 124 + E SL PVAKRL E L EV P +G EV+K LK G+V++LEN RFH E Sbjct: 64 KRVEELSLKPVAKRLGEYLDMEVTLAPDCIGAEVEKMAAGLKAGQVMMLENLRFHAEEQA 123 Query: 125 KNDPELAKF---WASLADIHVNDAFGTAHRAHASNVGIAQFIPS-VAGFLMEKEIKFLSK 180 K E F A+LADI+VNDAFG AHR +AS V + AGFL++ E ++L + Sbjct: 124 KTVEERGDFGAKLAALADIYVNDAFGVAHRPNASVVDVPYAAKQCCAGFLLKLEWEYLGE 183 Query: 181 VTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEE 240 NP++PY+ V GGAKVS K+G++ NL+ K D +IGGAM TFL A GK+VG S VE Sbjct: 184 ALKNPKRPYIAVSGGAKVSSKLGILNNLIGKVDHFIIGGAMANTFLLAQGKDVGKSLVEA 243 Query: 241 DKIDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPET 300 +D AK+++ KA+ G + LPVD + + IE + D +P M LDIGP + Sbjct: 244 SLVDTAKKIITKAEGSGTTLHLPVDFIWGKDIE---NAGGICDADNVPTDGMLLDIGPVS 300 Query: 301 IELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAITVVGGGDSAAAV 360 + F + +AKT+VWNGPMG+FE FAEG+ +V A+A + T+VGGGD+ A V Sbjct: 301 AQKFCDVIKEAKTIVWNGPMGLFEQPAFAEGSLKVCKAMA---DSDGTTIVGGGDTDAVV 357 Query: 361 NKFGLEDKFSHVSTGGGASLEFLEGKELPGIASIAD 396 ++ GL DKFS +STGGG+ LEFLEGKELP ++ + Sbjct: 358 HQAGLADKFSFISTGGGSFLEFLEGKELPAFKALKE 393 Lambda K H 0.317 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 632 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 654 Length of database: 397 Length adjustment: 34 Effective length of query: 620 Effective length of database: 363 Effective search space: 225060 Effective search space used: 225060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory