Align UDP-glucose 4-epimerase (EC 5.1.3.2); UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.7) (characterized)
to candidate WP_027722079.1 H589_RS0111125 NAD-dependent epimerase/dehydratase family protein
Query= BRENDA::Q9WYX9 (309 letters) >NCBI__GCF_000425265.1:WP_027722079.1 Length = 318 Score = 177 bits (448), Expect = 4e-49 Identities = 119/321 (37%), Positives = 179/321 (55%), Gaps = 25/321 (7%) Query: 4 LVTGGAGFIGSHVVDKLIENGYGVIVVDNLSSGKVENL-----NRNALFYEQSIEDEEMM 58 LVTG AGFIGSH+ L++ G+ V+ VDN +G N+ N F+E SI D+ ++ Sbjct: 7 LVTGCAGFIGSHLTQTLLDAGHMVVGVDNFFTGYAHNMEGFRDNPRFCFHEASITDDGLL 66 Query: 59 ERIFSLHRP-EYVFHLAAQASVAISVREPARDAKTNIIGSLVLLEKSIKYGVKKFIFSST 117 ER+ +R + +F LAA SV SV P K N + ++ S K G+ FIF+ + Sbjct: 67 ERLKGENRELDVIFQLAAIVSVPYSVDHPELTMKVNYEANERIISSSQKLGISTFIFAGS 126 Query: 118 GGAIYGENVKVFPTPE--TEIPHPISPYGIAKYSTEMYLEFFAREYGLKYTVLRYANVYG 175 A YGE ++ P E + +SPYG+AKY T +E YG LR+ NV+G Sbjct: 127 A-AEYGEEHRL-PVREKYADEATQLSPYGVAKYKTSNLIEKCG--YGCS---LRFFNVFG 179 Query: 176 PRQDPYGE-AGVVAIFTERMLRGEEVHIFGDGEYVRDYVYVDDVVRANLLAMEKGDNE-- 232 PRQDP + +GV++ F + L G+ + IFGDGE RD++YV DVV + L+A DN+ Sbjct: 180 PRQDPTSQYSGVISKFVDFGLSGKNMIIFGDGEQTRDFLYVSDVVTSYLIAAGL-DNDGR 238 Query: 233 -----VFNIGTGRGTTVNQLFKLLKEITGYDKEPVYKPPRKGDVRKSILDYTKAKEKLGW 287 ++N+GTG +V QL + + ++T + + P R GD++ S+ K K G+ Sbjct: 239 GPLLGIYNVGTGNSISVLQLAETVAKLTSAPQNVEFMPERAGDIKHSLAHIGKI-SKAGF 297 Query: 288 EPKVSLEEGLKLTVEYFRKTL 308 + ++S EEGL TVE+ R + Sbjct: 298 KAEISFEEGLSKTVEWARSEI 318 Lambda K H 0.318 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 14 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 318 Length adjustment: 27 Effective length of query: 282 Effective length of database: 291 Effective search space: 82062 Effective search space used: 82062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory