Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_027723095.1 H589_RS0116790 UDP-N-acetylglucosamine 4,6-dehydratase (inverting)
Query= curated2:A8GWP0 (341 letters) >NCBI__GCF_000425265.1:WP_027723095.1 Length = 326 Score = 223 bits (569), Expect = 4e-63 Identities = 135/331 (40%), Positives = 193/331 (58%), Gaps = 11/331 (3%) Query: 1 MFVDKTLLITGGTGSFGNAVLSRFLKNDIIKDIKEIRIFSRDEKKQEDMRIALNNPK--- 57 MF DK++LITGGTGSFG ++ L+ K + IFSRDE KQ +M+ + K Sbjct: 1 MFNDKSILITGGTGSFGQKLVKTLLER---YSPKRLVIFSRDELKQHEMQQVFSPAKYPC 57 Query: 58 IKFYIGDVRNYNSIDDAMKDVDYVFHAAALKQVPTCEFYPMEAINTNILGAENVLRAATI 117 ++++IGDVR+ + A +D VFHAAALKQVP CE+ P EA+ TNILGA+N++ AA Sbjct: 58 LRYFIGDVRDQERLRRAFNKIDIVFHAAALKQVPACEYNPFEAVKTNILGAQNIVEAAID 117 Query: 118 NKVAKVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMNVRDKTVFCVTRYGNVMASRGS 177 V+KVIVLSTDKA P+N G +K +KL I+ + T F V RYGNV+ SRGS Sbjct: 118 KDVSKVIVLSTDKAANPVNLYGATKLCSDKLFISGNSYAGAEGTRFAVVRYGNVLGSRGS 177 Query: 178 VIPLFINQIKQNKDLTITEPSMTRFLMSLVDSVDLVLYAFEYGHQGDIFVQKSPASTIEV 237 V+PLF+ K+ K + IT P MTRF ++L ++D V+ + + G+IF+ K P+ I Sbjct: 178 VVPLFLKAAKEGK-VCITNPEMTRFWITLDAAIDFVINSLKVMQGGEIFIPKLPSMKIGD 236 Query: 238 LAKALQGIFNSKNKIRFIGTRHGEKHYESLVSSEEMAKAEDLGNYYRIPMDGRDLNYAKY 297 +A+A+ + K+ G R GEK +E +V E D G Y+ I R Sbjct: 237 MAEAM----CPECKVEITGIRPGEKMHEVMVPMNEAHNTLDCGKYFVIQPAYRFFERMDV 292 Query: 298 FVEGEKKIALLEDYTSHNTKRLNLEEVKELL 328 G+K + E + NT+ L+ EE+ +L+ Sbjct: 293 TCAGKKVPSDFEYSSDTNTEWLSKEELLKLV 323 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 326 Length adjustment: 28 Effective length of query: 313 Effective length of database: 298 Effective search space: 93274 Effective search space used: 93274 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory