Align GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_027723039.1 H589_RS0116465 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::G3LHY8 (358 letters) >NCBI__GCF_000425265.1:WP_027723039.1 Length = 365 Score = 183 bits (465), Expect = 5e-51 Identities = 108/321 (33%), Positives = 169/321 (52%), Gaps = 8/321 (2%) Query: 2 LELRNAAKMVGADYHIYPTDLVLERGTLNVLLGPTLAGKTSLMRLMAGLDRPTGGSIHFD 61 +EL+N K G+ I+ DL + VL+GP+ GK++L+R++AGL+ +GG IH Sbjct: 4 VELKNVIKRYGSVEVIHGVDLSVNENEFIVLVGPSGCGKSTLLRMVAGLENLSGGEIHIG 63 Query: 62 GTDVTGMPVQKRNVAMVYQQFINYPALTVYNNIASPMRISGKDAATIDREVRKAAELLKL 121 V + + RNVAMV+Q + YP +TV N+ +++ + I+ V +AA +L+L Sbjct: 64 DRVVNNVSPKDRNVAMVFQNYALYPHMTVGENMGFSLKMHKRSKEEIESRVNEAARILEL 123 Query: 122 TPYLDRTPLNLSGGQQQRTALARALVKNASLVLMDEPLANLDYKLREELREELPKIFAQS 181 PYL R P LSGGQ+QR A+ RA+V+N + L DEPL+NLD +LR ++R EL K+ + Sbjct: 124 EPYLHRKPAELSGGQRQRVAMGRAMVRNPDVFLFDEPLSNLDAQLRTQMRMELRKMHLRL 183 Query: 182 GAIFVYATTEPSEALLLGGNTATLNQGRVTQFGPTIEVYRRPVNLATAGIFADPPLNTLD 241 +Y T + EA+ L L G + Q G +EV+ +P N+ A +PP+N L+ Sbjct: 184 RTTTIYVTHDQIEAMTLADRIVILKDGYIQQVGSPVEVFEKPNNVFVAKFIGNPPMNILE 243 Query: 242 -VTK--SGNVFTRPSGVTIPVPSHLA--VVPDGPVTIAFHPHHLGLAPQTGDAAR---LQ 293 V K G + P+ +A +V PV P + + + Sbjct: 244 GVCKVIDGKRYVVIGKTRFPIQDGVAKSIVDGSPVLAGLRPDSIKMGQNIERLPKDWWCH 303 Query: 294 ARTLVSEITGSESFVHLEYDG 314 +VSEI G+ S + + DG Sbjct: 304 GEVVVSEILGAHSLLEIVIDG 324 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 365 Length adjustment: 29 Effective length of query: 329 Effective length of database: 336 Effective search space: 110544 Effective search space used: 110544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory